1FI4,2GS8


Conserved Protein Domain Family
mevDPdecarb

?
TIGR01240: mevDPdecarb 
Click on image for an interactive view with Cn3D
diphosphomevalonate decarboxylase
This enzyme catalyzes the last step in the synthesis of isopentenyl diphosphate (IPP) in the mevalonate pathway. Alternate names: mevalonate diphosphate decarboxylase; pyrophosphomevalonate decarboxylase [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 130307
View PSSM: TIGR01240
Aligned: 5 rows
Threshold Bit Score: 400.094
Threshold Setting Gi: 109158018
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FI4_A    26 ASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQddLRTLTSAA-T-APEFERDTLWLNG-EPHSIDNERTQNCLRDL 102 baker's yeast
AAG02451   6 ITVTSYANIAIIKYWGKENQAKMIPSTSSISLTLEN--MFTTTSVSfL-PDTATSDQFYINGvLQNDEEHTKISTIIDQF 82  Streptococcus pyogenes
P32377     6 ASVTAPVNIATLKYWGKRDTKLNLPTNSSISVTLSQddLRTLTSAA-T-APEFERDTLWLNG-EPHSIDNERTQNCLRDL 82  Saccharomyces cerev...
AAG02446   4 GKARAYTNIALIKYWGKKNEELILPMNNSLSLTLDA--FYTETEVI-F-SDSYMVDEFYLDGtLQDEKATKKVSQFLDLF 79  Enterococcus faecium
2GS8_A     9 ITVTSYANIAIIKYWGKENQAKXIPSTSSISLTLEN--XFTTTSVS-FlPDTATSDQFYINGiLQNDEEHTKISAIIDQF 85  Streptococcus pyoge...
1FI4_A   103 RQLRkeXEskdaslptlsqwKLHIVSENNFPTAAGLASSAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFG 182 baker's yeast
AAG02451  83 RQPG--QA------------FVKMETQNNMPTAAGLSSSSSGLSALVKACDQLFDTQLDQKALAQKAKFASGSSSRSFFG 148 Streptococcus pyogenes
P32377    83 RQLRkeMEskdaslptlsqwKLHIVSENNFPTAAGLASSAAGFAALVSAIAKLYQLPQSTSEISRIARKGSGSACRSLFG 162 Saccharomyces cerev...
AAG02446  80 RKEAglSL------------KASVISQNFVPTAAGLASSASGLAALAGACNTALKLGLDDLSLSRFARRGSGSACRSIFG 147 Enterococcus faecium
2GS8_A    86 RQPG--QA------------FVKXETQNNXPTAAGLSSSSSGLSALVKACDQLFDTQLDQKALAQKAKFASGSSSRSFFG 151 Streptococcus pyoge...
1FI4_A   183 GYVAWEXgkaedGhDSXAVQIADSsdwPQXKACVLVVSDIKKDVSSTQGXQLTVATSELFKERIEHVVPKrFEVXRKAIV 262 baker's yeast
AAG02451 149 PVAAWDK-----D-SGAIYKVETD---LKMAMIMLVLNAAKKPISSREGMKLCRDTSTTFDEWVEQSAID-YQHMLTYLK 218 Streptococcus pyogenes
P32377   163 GYVAWEMgkaedGhDSMAVQIADSsdwPQMKACVLVVSDIKKDVSSTQGMQLTVATSELFKERIEHVVPKrFEVMRKAIV 242 Saccharomyces cerev...
AAG02446 148 GFVEWEKgh--dDlSSYAKPVPSDsfeDDLAMVFVLINDQKKEVSSRNGMRRTVETSNFYQGWLDSVEGD-LYQLKQAIK 224 Enterococcus faecium
2GS8_A   152 PVAAWDKd------SGAIYKVETD---LKXAXIXLVLNAAKKPISSREGXKLCRDTSTTFDQWVEQSAID-YQHXLTYLK 221 Streptococcus pyoge...
1FI4_A   263 EKDFATFAKETXXDSNSFHATCLDSFPPIFYXNDTSKRIISWCHTINQfyGETIVAYTFDAGPNAVLYYLAENESKLFAF 342 baker's yeast
AAG02451 219 TNNFEKVGQLTEANALAMHATTKTANPPFSYLTKESYQAMEAVKELRQ--EGFACYFTMDAGPNVKVLCLEKDLAQLAER 296 Streptococcus pyogenes
P32377   243 EKDFATFAKETMMDSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQfyGETIVAYTFDAGPNAVLYYLAENESKLFAF 322 Saccharomyces cerev...
AAG02446 225 TKDFQLLGETMERNGLKMHGTTLAAQPPFTYWSPNSLKAMDAVRQLRK--QGIPCYFTMDAGPNVKVLVENSHLSEVQET 302 Enterococcus faecium
2GS8_A   222 TNNFEKVGQLTEANALAXHATTKTANPPFSYLTKESYQAXEAVKELRQ--EGFACYFTXDAGPNVKVLCLEKDLAQLAER 299 Streptococcus pyoge...
1FI4_A   343 IYKLFG 348 baker's yeast
AAG02451 297 LGKNYR 302 Streptococcus pyogenes
P32377   323 IYKLFG 328 Saccharomyces cerevisiae S288c
AAG02446 303 FTKLFS 308 Enterococcus faecium
2GS8_A   300 LGKNYR 305 Streptococcus pyogenes M1 GAS
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap