Conserved Protein Domain Family
Pmev_kin_Gr_pos

?
TIGR01220: Pmev_kin_Gr_pos 
phosphomevalonate kinase, ERG8-type, Gram-positive branch
This enzyme is part of the mevalonate pathway, one of two alternative pathways for the biosynthesis of IPP. In an example of nonorthologous gene displacement, two different types of phosphomevalonate kinase are found - the animal type and this ERG8 type. This model represents the low GC Gram-positive organism forms of the ERG8 type of phosphomevalonate kinase. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 130287
View PSSM: TIGR01220
Aligned: 3 rows
Threshold Bit Score: 576.084
Threshold Setting Gi: 9695272
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB07792   8 IVRHAPGKLFVAGEYAVVDPGNPAILVAVDRHISVTVSDADadtGAaDVVISSDLGPQAVGWRWHDGRLVVRDPddgqqa 87  Streptomyces sp. CL190
AAG02442   2 IEVTTPGKLFIAGEYAVVEPGHPAIIVAVDQFVTVTVEETT---DE-GSIQSAQYSSLPIRWTRRNGELVLDIR------ 71  Enterococcus faecalis
AAG02432   2 IQVKAPGKLYVAGEYAVTEPGYKSVLIAVDRFVTASIEASN---AVtSTIHSKTLHYEPVTFNRNEDKIDISDAn----a 74  Staphylococcus haem...
BAB07792  88 RSALAHVVSAIETVGRLLGERGQKVPALTLSVSSRLHE-DGRKFGLGSSGAVTVATVAAVAAFCGLELSTDERFRLAMLA 166 Streptomyces sp. CL190
AAG02442  72 ENPFHYVLAAIHLTEKYAQEQNKELSFYHLKVTSELDSsNGRKYGLGSSGAVTVGTVKALNIFYDLGLENEEIFKLSALA 151 Enterococcus faecalis
AAG02432  75 ASQLKYVVTAIEVFEQYARSCNVKLKHFHLEIDSNLDDaSGNKYGLGSSAAVLVSVVKALNEFYDMQLSNLYIYKLAVIS 154 Staphylococcus haem...
BAB07792 167 TAELDPKGSGGDLAASTWGGWIAYQAPDRAFVLDLARRVGVDRTLKAPWPGHSVRRLPAPKGLTLEVGWTGEPASTASLV 246 Streptomyces sp. CL190
AAG02442 152 HLAVQGNGSCGDIAASCYGGWIAFSTFDHDWVNQKVTTETLTDLLAMDWPELMIFPLKVPKQLRLLIGWTGSPASTSDLV 231 Enterococcus faecalis
AAG02432 155 NMRLQSLSSCGDIAVSVYSGWLAYSTFDHDWVKQQMEETSVNEVLEKNWPGLHIEPLQAPENMEVLIGWTGSPASSPHLV 234 Staphylococcus haem...
BAB07792 247 SDLHRRTWRGSASHQRFVETTTDCVRSAVTALESGDDTSLLHEIRRARQELARLDDEVGLGIFTPKLTALCDAAEAVGGA 326 Streptomyces sp. CL190
AAG02442 232 DRVHQSKEEKQAAYEQFLMKSRLCVETMINGFNTGKISVIQKQITKNRQLLAELSSLTGVVIETEALKNLCDLAESYTGA 311 Enterococcus faecalis
AAG02432 235 SEVKRLKSDP-SFYGRFLDQSHTCVENLIYAFKTDNIKGVQKMIRQNRMIIQQMDNEATVDIETENLKMLCDIGERYGAA 313 Staphylococcus haem...
BAB07792 327 AKPSGAGGGDCGIALLDAEAsrDITHVRQRWETAGVLPLPLTPALEG 373 Streptomyces sp. CL190
AAG02442 312 AKSSGAGGGDCGIVIFRQKS--GILPLMTAWEKDGITPLPLHVYTYG 356 Enterococcus faecalis
AAG02432 314 AKTSGAGGGDCGIAIIDNRI--DKNRIYNEWASHGIKPLKFKIYHGQ 358 Staphylococcus haemolyticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap