Conserved Protein Domain Family
chvA

?
TIGR01192: chvA 
glucan exporter ATP-binding protein
This model describes glucan exporter ATP binding protein in bacteria. It belongs to the larger ABC transporter superfamily with the characteristic ATP binding motif. The In general, this protein is in some ways implicated in osmoregulation and suggested to participate in the export of glucan from the cytoplasm to periplasm. The cyclic beta-1,2-glucan in the bactrerial periplasmic space is suggested to confer the property of high osmolority. It has also been demonstrated that mutants in this loci have lost functions of virulence and motility. It is unclear as to how virulence and osmoadaptaion are related. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 130260
View PSSM: TIGR01192
Aligned: 3 rows
Threshold Bit Score: 1057.57
Threshold Setting Gi: 116399
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1568621    47 VSLFRTYVRVLSYLNQEKNAFLLICTANITLAIITIAEPILFGHVIDTIADKSDTLVTLAVWMCFGISNIIAYVLVARGA 126
gi 148887405   1 MSLFQVYARALQYLAVHKFRVGAIVIANIVLAAITIAEPILFGRIIDAISSQKDVAPMLLLWAGFGVFNTIAFVLVSREA 80
gi 116399      1 MTLFQVYTRALRYLTVHKWRVAVVVIANVILAAITIAEPVLFGRIIDAISSGTNVTPILILWAGFGVFNTVAYVAVAREA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1568621   127 DRLAHRCRLTVLEKSFARIISMPLIWHQQRGTSHALHTLLRATDSMSSIWLEFMRQHLSTFVALFVLVPVTFKMNWRLSI 206
gi 148887405  81 DRLAHGRRASLLTEAFGRIVSMPLSWHSQRGTSNALHTLLRACETLFGLWLEFMRQHLATAVALMLLIPTAFAMDVRLSL 160
gi 116399     81 DRLAHGRRATLLTEAFGRIISMPLSWHHLRGTSNALHTLLRASETLFGLWLEFMRTHLATFVALVLLIPTAMAMDLRLSF 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1568621   207 VLMVLAILYILIARLVMQKTKNGQAAVEHYHHNLFKHITDSISNVSIVQSYNRITEETSALHQHTNNLLSAQTPVLNWWA 286
gi 148887405 161 ILVVLGAAYVMISKVVMSRTKEGQAAVEGHYHTVFSHVSDSISNVSVVHSYNRIEAETRELKKFTQRLLSAQYPVLDWWA 240
gi 116399    161 VLIGLGIVYWFIGKWVMGRTKDGQASVEEHYHSVFAHVSDSISNVSVLHSYNRIEAETKALKSFTEKLLSAQYPVLDWWA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1568621   287 LASGLNRMASTISIVCVLLLGAFFVIKGQLSVGEVVTFVGFSQLMIGRLDQISGFINLAVSSQAKLQEFFDMEDSTFQTN 366
gi 148887405 241 LASGLNRIASTISMMAILVIGTVLVQRGELGVGEVIAFIGFANLLIGRLDQMKAFATQIFEARAKLEDFFQLEDSVQDRE 320
gi 116399    241 FASALNRTASTVSMMIILVIGTVLVKNGELRVGDVIAFIGFANLLIGRLDQMRQFVTQIFEARAKLEDFFVLEDAVKERE 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1568621   367 EPANLPSLPNVKGAIQFHHVTYEFPNSSQGVFDISFEVKAGQTVAIVGPTGAGKTTLINLLQRVYDPTVGYISIDGININ 446
gi 148887405 321 EPADAGELKGVVGEVEFRDISFDFANSAQGVRNVSFKAKAGQTIAIVGPTGAGKTTLVNLLQRVHEPKHGQILIDGVDIA 400
gi 116399    321 EPGDARELSNVSGTVEFRNINFGFANTKQGVHDVSFTAKAGETVAIVGPTGAGKTTLINLLQRVYDPDSGQILIDGTDIS 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1568621   447 SINRESLRKALATVFQDAGLFDRTIRDNISIGKTGATDEELYEATKTASAHDFILKKSKNYDTLVGERGSQLSGGERQRL 526
gi 148887405 401 TVTRKSLRRSIATVFQDAGLMNRSIGENIRLGREDASLDEVMAAAEAAAASDFIEDRLNGYDTVVGERGNRLSGGERQRV 480
gi 116399    401 TVTKNSLRNSIATVFQDAGLLNRSIRENIRLGRETATDAEVVEAAAAAAATDFIDSRINGYLTQVGERGNRLSGGERQRI 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1568621   527 AIARAILKNAPILILDEATSALDVETEIRVKNAIDCISQNRTTFIIAHRLSTIRNADLVLFLDQGRLIEKGSFQELINKD 606
gi 148887405 481 AIARAILKNAPILVLDEATSALDVETEARVKDAIDALRKDRTTFIIAHRLSTVREADLVIFMDQGRVVEMGGFHELSQSN 560
gi 116399    481 AIARAILKNAPILVLDEATSALDVETEARVKAAVDALRKNRTTFIIAHRLSTVRDADLVLFLDQGRIIEKGTFDELTQRG 560
                        570       580       590
                 ....*....|....*....|....*....|..
gi 1568621   607 GHFYKLLKRGGLTINQPATKekddniiPLRKA 638
gi 148887405 561 GRFAALLRASGILTDEDVRK-------SLTAA 585
gi 116399    561 GRFTSLLRTSGLLTEDEGQQ-------PRPKA 585
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap