Conserved Protein Domain Family
potA

?
TIGR01187: potA 
spermidine/putrescine ABC transporter ATP-binding subunit
This model describes spermidine/putrescine ABC transporter, ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Polyamines like spermidine and putrescine play vital role in cell proliferation, differentiation, and ion homeostasis. The concentration of polyamines within the cell are regulated by biosynthesis, degradation and transport (uptake and efflux included). [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 162242
View PSSM: TIGR01187
Aligned: 6 rows
Threshold Bit Score: 502.409
Threshold Setting Gi: 10955064
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146345487  41 ILGPSGCGKTTVLRLLAGLEELDSGSIILDGEDITNVPAEKRHINTVFQSYALFPHMTIFENVAFGLRMQKVPNEEIKPR 120
gi 3341854    41 ILGPSGCGKTTVLRLLAGLEELDSGNIILDGEDITNVPAEKRHVNTVFQSYALFPHMTIFENVAFGLRMQKVPEAEIKPR 120
gi 130688     48 LLGPSGCGKTTVLRLIAGLETVDSGRIMLDNEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPR 127
gi 2677720     3 LLGSSGSGKTTLLMLLAGFDQPSEGKVLMSGTSVTEVPPHRRSIGVVFQNYALFPHMTAAENVAYPLKMRGVGRSERDER 82
gi 485695467  77 LLGASGCGKSTLLRMLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASR 156
gi 586953417 108 LLGPSGSGKTTLLMTLAGFIRPDFGSLKFGEEEVILRAPHLRGVGMMFQNYALFPHMSVEANIAYPLKIRGEDRETIKAR 187
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146345487 121 VLEALRMVQLEEMADRKPTQLSGGQQQRIAIARAVVNKPKVLLLDESLSALDYKLRKQMQQELKMLQRQLGITFIFVTHD 200
gi 3341854   121 VLEALRMVQLEEMADRKPTQLSGGQQQRIAIARAVVNKPKVLLLDESLSALDYKLRKQMQYELKVLQRQLGITFIFVTHD 200
gi 130688    128 VMEALRMVQLETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQRKLGITFVFVTHD 207
gi 2677720    83 VKAALSLVNLTDRGASYPIQMSGGQQQRVALARSLVFGPDILLMDEPLGALDRRLRDQMQHELKRIQHELGITVIYVTHD 162
gi 485695467 157 VNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHD 236
gi 586953417 188 VRDVLETVQLGGYGSRRISELSGGQRQRIALARAIVFKPKILLMDEPLSALDKNLRELMQLELRTMHEQLGMTTVLVTHD 267
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146345487 201 QEEAITMSDRIVLLRKGKIAQDGSPREIYEDPANLFVARFIGEINVFEATVIERKSEQVVLAN-VEGRICDIYTDMPVEK 279
gi 3341854   201 QEEAITMSDRIVLLRKGKIAQDGSPREIYEEPANLFVARFIGEINVFDATVIERKSENVVLAN-VEGRVCDIYTDIPVKK 279
gi 130688    208 QEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEINMFNATVIERLDEQRVRAN-VEGRECNIYVNFAVEP 286
gi 2677720   163 QSEAMAMADRIGIMSGGELLQVADPETIYAAPSNHFVARFIGDCSILRVTNLDEGRGYEIAGG---------RQLLPSPA 233
gi 485695467 237 QEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGVLKERQEDGLVLDSpGLVHPLKVDADASVVD 316
gi 586953417 268 QREALTMSDRIAVLRNGKIAQIDTSETLYSEPNSEFVAAFMGESS---FLTVEHDGASFCFHG-----RKLATESVTVEG 339
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146345487 280 DQKLQVLLRPEDIVIEELDENEHSK--AIIGHIIDRTYKGMTLESTVEFDHNGMrVLVSEFFNEDDPHMD--HSIGQRVG 355
gi 3341854   280 DQQLQVLLRPEDIVIKELDEHEHSK--AIIGHIIDRTYKGMTLESTVEFEQNGKrGLVSEFFNEDDPHMD--HSIGQRVG 355
gi 130688    287 GQKLHVLLRPEDLRVEEINDDNHAE--GLIGYVRERNYKGMTLESVVELE-NGKmVMVSEFFNEDDPDFD--HSLDQKMA 361
gi 2677720   234 KTPFDIVVRPESVSIRSVAEANSDEgfAVPATIRDITYLGSGWRVALQISDGQS--LLANVMRGDLLAGS--LEPGKSVI 309
gi 485695467 317 NVPVHVALRPEKIMLCEEPPANGCN--FAVGEVIHIAYLGDLSVYHVRLKSGQ---MISAQLQNAHRHRKglPTWGDEVR 391
gi 586953417 340 ARRHLLVLRPEKLDFITERERSSYN--SFDGIVEKFLFQGESCLVHVRLTTG---ELVQVRRNLRESNKSvlPKVNDQVL 414
                        330
                 ....*....|.
gi 146345487 356 ITWHEGWEVVL 366
gi 3341854   356 ITWHEGWEVVL 366
gi 130688    362 INWVESWEVVL 372
gi 2677720   310 ARWAPASVAVL 320
gi 485695467 392 LCWEVDSCVVL 402
gi 586953417 415 LGLHPNETRIV 425
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap