Conserved Protein Domain Family
ntrCD

?
TIGR01184: ntrCD 
nitrate transport ATP-binding subunits C and D
This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase. [Transport and binding proteins, Anions, Transport and binding proteins, Other]
Statistics
?
PSSM-Id: 130252
View PSSM: TIGR01184
Aligned: 6 rows
Threshold Bit Score: 454.231
Threshold Setting Gi: 585583
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 585583   36 IEDVNLSVQQGEFICVIGHSGCGKSTLLNLVSGFSQPTSGGVYLDGQPIQEPGPDRMVVFQNYSLLPWKSARDNIALAVK 115
gi 1019381  40 LDGVNLTVQEGEFICVIGHSGCGKSTLLNMVSGFNQPSHGSVRLKGKEIDRPGPDRMVVFQNYALLPWMTAYENVYLAVD 119
gi 2492543  25 LKNIELKISQGEFISLIGHSGCGKSTLLNMISGLDKPTFGGVIMEGKEITEPGPERMVVFQNYSLLPWLTVRQNIALAVN 104
gi 1019380  25 LKGIDLEIKQGEFISLIGHSGCGKSTLLNLIAGLELPTDGAVSLEGQQITAPGPDRMVVFQNYSLFPWLTVRENIALAVD 104
gi 1154891  25 LKNIDLTIRKGEFVSLLGHSGCGKSTLLNIIAGLAKPAAGALILEGRQVTEPGPDRMVVFQNYSLLPWLTVRENIALAVN 104
gi 585582   25 LKDVSLNIRPGEFISLIGHSGCGKSTLLNLIAGLAQPSSGGIILEGRQVTEPGPDRMVVFQNYSLLPWRTVRQNIALAVD 104
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 585583  116 AARPHLSTSEQRQVVDHHLELVGLTEAQHKRPDQLSGGMKQRVAIARALSIRPEVLILDEPFGALDAITKEELQEELLNI 195
gi 1019381 120 CVNPQMREGEKREIVREHLAMVGLTEAAEKKITQISGGMKQRVAIARALSIRPEVLILDEPFGALDAITKEELQEELLKI 199
gi 2492543 105 RVLRDLPKPEQEKIIDDNIALVGLQRAAHKRPGELSGGMKQRVAIARALSTRPKVLLLDEPFGALDALTRGNLQERLMEI 184
gi 1019380 105 EVLRDLPKEERQAIVEEHIQLVGLGHAADKPPAQLSGGMKQRVAIARGLATRPKLLLLDEPFGALDALTRGNLQEKLMQI 184
gi 1154891 105 RVMATASKSEREAIVEQHIDLVNLRHAADKRPGQLSGGMKQRVAIARALSIRPKLLLLDEPFGALDALTRSSLQDQLMQI 184
gi 585582  105 SVLHDRNRTERRTIIEETIDLVGLRAAADKYPHEISGGMKQRVAIARGLAIRPKLLLLDEPFGALDALTRGNLQEQLMRI 184
                      170       180       190       200       210       220       230
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 585583  196 WEEARPTVLMITHDIDEALFLADRVVMMTNGPAATIGEVLEIPFDRPREREAVVEDPRYAQLRTEALDFL 265
gi 1019381 200 WNDHRCTVLMITHDIDEALFLADRLVMMTNGPAANIGEIMTIPFPRPRDRERIMEDPQYYDLRNYALDFL 269
gi 2492543 185 VQESGVTCIMVTHDVDEALLLSDRVVMLTTGPEAHIGQILEVPIPRPRHRLEVVNHPSYYALRGEMVYFL 254
gi 1019380 185 CEENHVTAVMVTHDVDEAVLLSDRIVMLTNGPGSKIGGILEVDIPRPRKRMDVVHHPSYYSLRSEIIYFL 254
gi 1154891 185 AEEHELTCIMVTHDVDEALLLSDRIVMLTNGPESYIGQIMDVPFERPRDRLEVVNDPSYYGMRSEIVYFL 254
gi 585582  185 CQEAGVTAVMVTHDVDEALLLSDRVVMLTNGPAAQIGQILEVDFPRPRQRLEMMETPHYYDLRNELINFL 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap