Conserved Protein Domain Family
eps_transp_fam

?
TIGR01005: eps_transp_fam 
exopolysaccharide transport protein family
The model describes the exopolysaccharide transport protein family in bacteria. The transport protein is part of a large genetic locus which is associated with exopolysaccharide (EPS) biosynthesis. Detailed molecular characterization and gene fusion analysis revealed atleast seven gene products are involved in the overall regulation, which among other things, include exopolysaccharide biosynthesis, property of conferring virulence and exopolysaccharide export. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 273391
View PSSM: TIGR01005
Aligned: 2 rows
Threshold Bit Score: 1198.38
Threshold Setting Gi: 2498330
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q45409    15 ENELDLVRYLDVLVANRWLIAGIAAAVMLLGAAYAFLARPVYEADIMVQVEDNPNSAKSLLGDVSSLFDVKTDANAEIEI 94  Ralstonia solanacearum
2009367F  25 DGFIDLDRLVAAVFRRARLVAAFVVLFIALGAAYLLFATPYYTSMTQILLDENLSKYAEEEPTPVNSQMLDTQIASAVEI 104 Sinorhizobium meliloti
Q45409    95 LRSRMVVGKAVDNLHLYITAKPR---YFP--LIGAWISSRATRLSepGLFGLGGYVWGTESIDVDGFDVPEALEGQPFKL 169 Ralstonia solanacearum
2009367F 105 LKSGELALRVVDKLKLSENDTILnppRSPvdMVKEWLKTATGLFS--GGPDVTEEAARNGRRQKAAAIIQQSLAVERVSR 182 Sinorhizobium meliloti
Q45409   170 IVLGNGRYRLENKSLDAPIEGVVGEPLEAKQSIGTIQLQVNNLTAKAGATFELERDSRLKTMEMLQDKLKIAEKGKQSGI 249 Ralstonia solanacearum
2009367F 183 SSVVAVAFRSSDPLLAATIARGYASAYLTDQLNANFEATERASVWLQERLTDLQQRSQAAALEVAHFRAENGLTAARGEL 262 Sinorhizobium meliloti
Q45409   250 IG-ASLDGTNPALTAAIMNQIATEYVAQNIKRKAEEAERSLVFLDGLLPQLKLELERAEMKYNEMRNLRGTFDLSEEGKA 328 Ralstonia solanacearum
2009367F 263 MSeQQMADLNSQLIVAQADTASASARYDQYKSIVDQGPENAVKNATISSKEGDNSVIRDLRTRYLTVGKREREVSDNFGA 342 Sinorhizobium meliloti
Q45409   329 FLQESVTVETSLQELKQKRAELLTRFTSSHPGVQAIDQQIS-VMSGKVNSMTRRLKSLPNIEQDTVRLMRDVQVDNELYV 407 Ralstonia solanacearum
2009367F 343 DHPQAVCSAPSRRMSRAQIYQELQQLTASYKNEYEVAQSREeSLRKSIQGIAGKTSDASEQLVQLRELEQKAAALKTLYE 422 Sinorhizobium meliloti
Q45409   408 SLLNDMQQLKLVKAGKVGNVRLVDGAAVPEEPVKPKKLTVTPLAGVLGVVLGVMAAFVRNALFGGITDPQDIEEHTGLSV 487 Ralstonia solanacearum
2009367F 423 SYLGRYEQATQQQSFPIAKARVISEAGVPVSPSSPKKTMTLALSAVLGMMVGGAYAAFLEFRERTFRLEGNIRSILGHRS 502 Sinorhizobium meliloti
Q45409   488 YATVPLSDTQVDLSGQLTTRKRG--------------QYLLARRVPDDPS---IEALRSLRTALQFAMQDAGNNLVVLTG 550 Ralstonia solanacearum
2009367F 503 LGYVPLLGTRMKKKAQLVHAHFGsvkrhdeavddtmpFQRLSRIVVDAPRstfAETFRNAKLACDQMLAGSESRVIAIAS 582 Sinorhizobium meliloti
Q45409   551 PTPGVGKSFVSANLAAVIATGGKRVLLIDADMRKGYLHQYFGKDRKPGLLDLLAGNRSIEQVVHREVVPGLDFIATG--- 627 Ralstonia solanacearum
2009367F 583 ALPDEGKSIIAANFAALLAASGKRTLLIDADIRKPGLTQMITPAPRTGLVETLIGEASWPAGIKVDQRTKLAILPAGgas 662 Sinorhizobium meliloti
Q45409   628 LFPHNPSELLLNPRMVELMDTFRSQYDLVLVDTPPVLAVADTAILAARAGLVLLVTRFERSTLGEIRETIKQLQHANVDV 707 Ralstonia solanacearum
2009367F 663 HQRHQSNELLASPAMANLIENARNAFDYVVVDLAALAPVVDAKAFAPLADGILFVVEWGRTPSRLVRDLLHSEPLINSKV 742 Sinorhizobium meliloti
Q45409   708 RGVVFNALDPNTY-RYGYGSRYGRYRYVQYGYTSNSKPPEAESA 750 Ralstonia solanacearum
2009367F 743 LGVILNKTDMNELgKYSDFDGAEKYRHRYGKYYVENTITENTAA 786 Sinorhizobium meliloti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap