2P67,3MD0


Conserved Protein Domain Family
lao

?
TIGR00750: lao 
Click on image for an interactive view with Cn3D
LAO/AO transport system ATPase
In E. coli, mutation of this kinase blocks phosphorylation of two transporter system periplasmic binding proteins and consequently inhibits those transporters. This kinase is also found in Gram-positive bacteria, archaea, and the roundworm C. elegans. It may have a more general, but still unknown function. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however. [Transport and binding proteins, Amino acids, peptides and amines, Regulatory functions, Protein interactions]
Statistics
?
PSSM-Id: 129833
View PSSM: TIGR00750
Aligned: 7 rows
Threshold Bit Score: 449.994
Threshold Setting Gi: 3915402
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2P67_A        19 GERATLAQAMTLVESRHPRhqalSTQLLDAIM----PYCGNTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDP 94
gi 3915402    13 GNRRALARAITYVENEYPE----SKEIMRQIF----AKTGRAHVVGLTGFPGVGKSTLVSKLTEEFRRRGKKVGIIAIDP 84
gi 3915504    14 GDRRAVAKLITLVENDESK----AKVIIKKIY----PLTGNAHIVGITGPPGAGKSTLLDKLIKEARREGLIVGVIAVDP 85
gi 3915555    21 GDRAALPRAITLVESTRPDhreqAQQLLLRLL----PDSGNAHRVGITGVPGVGKSTAIEALGMHLIERGHRVAVLAVDP 96
gi 499168249  14 GNLRALGRLLTLVENPGSE----AVELLERLS----SRAGRAQVIGFTGIPGAGKSTLVSRVITGLRRRGYRVAVVAIDP 85
gi 1723836    17 GERATLAQAMTLVESRHPRhqalSTQLLDAIM----PYCGNTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDP 92
3MD0_A        42 GDRAALPRAITLVESTRPD----HREQAQQLLlrllPDSGNAHRVGITGVPGVGKSTAIEALGMHLIERGHRVAVLAVDP 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2P67_A        95 SSPVTGGSILGDKTRMNDLA------RAEAAFIRPVPSSGHLGGASQRARELMLLCEAAGYDVVIVETVGVGQSETEVAR 168
gi 3915402    85 GSPFTGGALLGDRLRLDGMDsrkqlwTDPGIFFRSMSSRGRAGGLAAKTGDVVRLLDAFGFDVILVETVGAGQSEVDIIE 164
gi 3915504    86 TSPFTGGALLGDRIRMQRHS------TDPGVFIRSMATRGSLGGLSKATNDAIKILDAYGCDVIFVETVGVGQIEVDIVK 159
gi 3915555    97 SSTRTGGSILGDKTRMARLA------VHPNAYIRPSPTSGTLGGVTRATRETVVLLEAAGFDVILIETVGVGQSEVAVAN 170
gi 499168249  86 TSPFSGGSIMGDRLRMQEHA------ADPGVFIRSIPTRGIKGGLSMAALAMIEVFDAMGYDKIIIETVGVGQSEVDIIN 159
gi 1723836    93 SSPVTGGSILGDKTRMNDLA------RAEAAFIRPVPSSGHLGGASQRARELMLLCEAAGYDVVIVETVGVGQSETEVAR 166
3MD0_A       118 SSTRTGGSILGDKTRMARLA------VHPNAYIRPSPTSGTLGGVTRATRETVVLLEAAGFDVILIETVGVGQSEVAVAN 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2P67_A       169 MVDCFISLQIAGGGDDLQGIKKGLMEVADLIVINKDDGDNHTN-VAIARHMYESALH-------------------ILRR 228
gi 3915402   165 VADTSVVVMMPETGDEIQVNKAGILEIGDIYVVNKADLGGAEKvERWLRYMLSLDEEsvqmlsqmthadearvqsgEFFE 244
gi 3915504   160 TADTVVLVTIPGLGDDVQTIKAGLMEIADIFVVNKADREGAD--ITYFELTLALDLEk------------------EKWE 219
gi 3915555   171 MVDTFVLLTLARTGDQLQGIKKGVLELADIVVVNKADGEHHKE-ARLAARELSAAIR-------------------LIYP 230
gi 499168249 160 AAHTIIVVTMPGAGDDVQALKAGVMEIGDIYVVNKSDKPEAN--KTAAYLQFALEKE-------------------DIGR 218
gi 1723836   167 MVDCFISLQIAGGGDDLQGIKKGLMEVADLIVINKDDGDNHTN-VAIARHMYESALH-------------------ILRR 226
3MD0_A       192 MVDTFVLLTLARTGDQLQGIKKGVLELADIVVVNKADGEHHKE-ARLAARELSAAIR-------------------LIYP 251
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2P67_A       229 KYDEWQPRVLTCSALEKRGIDEIWHAIIDFKTALTASGRLQQVRQQQSVEWLRKQTEEEVLNHLFANEdfdrYYRQTLLA 308
gi 3915402   245 RRKGWNPPVIKTVADRGEGIKELADAIEEHFDYMKKTGLIEKRRRERVKRELFEIVMNDVIKLVKEKT----NYRDLLVK 320
gi 3915504   220 K-IGWKPPIIETVGTTGKGVKELWEKIKEHKKFLEESGKLAEKRRTRIEEEVKTIIAGIVAKKVEASLs---EFEDIISM 295
gi 3915555   231 REALWRPPVLTMSAVEGRGLAELWDTVERHRQVLTGAGEFDARRRDQQVDWTWQLVRDAVLDRVWSNPtvrkVRSELERR 310
gi 499168249 219 RESGWRPKLVKTSAVLGQGIDPLVDAIEEHWRFARNTGLHTEKVKARRLLLAKMLAESLLSSKVSAAMe---VHRTLLEE 295
gi 1723836   227 KYDEWQPRVLTCSALEKRGIDEIWHAIIDFKTALTASGRLQQVRQQQSVEWLRKQTEEEVLNHLFANEdfdrYYRQTLLA 306
3MD0_A       252 REALWRPPVLTMSAVEGRGLAELWDTVERHRQVLTGAGEFDARRRDQQVDWTWQLVRDAVLDRVWSNPtvrkVRSELERR 331
                        330
                 ....*....|....*..
2P67_A       309 VKNNTLSPRTGLRQLSE 325
gi 3915402   321 LLKGETDPYTAAEQIVE 337
gi 3915504   296 VLNKDLDPYSAADLVLE 312
gi 3915555   311 VRAGELTPALAAQQILE 327
gi 499168249 296 AAASGKGLFRAAEVVAR 312
gi 1723836   307 VKNNTLSPRTGLRQLSE 323
3MD0_A       332 VRAGELTPALAAQQILE 348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap