2D8A


Conserved Protein Domain Family
tdh

?
TIGR00692: tdh 
Click on image for an interactive view with Cn3D
L-threonine 3-dehydrogenase
This protein is a tetrameric, zinc-binding, NAD-dependent enzyme of threonine catabolism. Closely related proteins include sorbitol dehydrogenase, xylitol dehydrogenase, and benzyl alcohol dehydrogenase. Eukaryotic examples of this enzyme have been demonstrated experimentally but do not appear in database search results.E. coli His-90 modulates substrate specificity and is believed part of the active site. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 129775
View PSSM: TIGR00692
Aligned: 4 rows
Threshold Bit Score: 603.771
Threshold Setting Gi: 126030241
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D8A_A        7 AIXKTKPGYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPQIXGHEVAGEVVEIGPGVEGIEVG 86
gi 135560     3 ALSKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMVVGHEYVGEVVGIGQEVKGFKIG 82
gi 3915097    8 ALMKKDGAFGAVLTEVPIPEIDKHEVLIKVKAASICGTDVHIYNWDQWARQRIKTPYVFGHEFSGIVEGVGENVSSVKVG 87
gi 29427393   7 AIMKTKPGYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPQIMGHEVAGEVVEIGPGVEGIEVG 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D8A_A       87 DYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLAGPI 166
gi 135560    83 DRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDL 162
gi 3915097   88 EYVSAETHIVCGECVPCLTGKSHVCTNTAIIGVDTAGCFAEYVKVPADNIWRNPADMDPSIASIQEPLGNAVHTVLESQP 167
gi 29427393  87 DYVSVETHIVCGKCYACRRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLAGPI 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D8A_A      167 SGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVXDITDGNGVDVFLEFSGA 246
gi 135560   163 VGEDVLVSGAGPIGIMAAAVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVGLEMSGA 242
gi 3915097  168 AGGTTAVIGCGPIGLMAVAVAKAAGASQVIAIDKNEYRLRLAKQMGATCTVSIEKEDPLKIVSALTSGEGADLVCEMSGH 247
gi 29427393 167 SGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVMDITDGNGVDVFLEFSGA 246
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2D8A_A      247 PKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNnLIIFKALTIYGITGRHLWETWYTVSRLLQSgKLNLDPIITHKYKgFD 326
gi 135560   243 PPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWT-KVIFKGLFIKGIYGREMFETWYKMAALIQS-GLDLSPIITHRFS-ID 319
gi 3915097  248 PSAIAQGLAMAANGGRFHILSLPEHPVTIDLTnKVVFKGLTIQGITGRKMFSTWRQVSQLISSnMIDLAPVITHQFP-LE 326
gi 29427393 247 PKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNnLIIFKALTIYGITGRHLWETWYTVSRLLQSgKLNLDPIITHKYKgFD 326
                       330       340
                ....*....|....*....|.
2D8A_A      327 KYEEAFELXRAGKTGKVVFXL 347
gi 135560   320 DFQKGFDAMRSGQSGKVILSW 340
gi 3915097  327 EFEKGFELMRSGQCGKVILIP 347
gi 29427393 327 KYEEAFELMRAGKTGKVVFML 347
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap