3MT6,2ZL0,3TT7


Conserved Protein Domain Family
clpP

?
TIGR00493: clpP 
Click on image for an interactive view with Cn3D
ATP-dependent Clp endopeptidase, proteolytic subunit ClpP
This model for the proteolytic subunit ClpP has been rebuilt to a higher stringency. In every bacterial genome with the ClpXP machine, a ClpP protein will be found that scores well with this model. In general, this ClpP member will be encoded adjacent to the clpX gene, as were all examples used in the seed alignment. A large fraction of genomes have one or more additional ClpP paralogs, sometimes encoded nearby and sometimes elsewhere. The stringency of the trusted cutoff used here excludes the more divergent ClpP paralogs from being called authentic ClpP by this model. [Protein fate, Degradation of proteins, peptides, and glycopeptides]
Statistics
?
PSSM-Id: 188055
View PSSM: TIGR00493
Aligned: 10 rows
Threshold Bit Score: 357.947
Threshold Setting Gi: 384872324
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3MT6_R  14 MALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDT 93  Escherichia coli ATCC...
P43867   1 MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIVAQLLFLESEDPTKDINIYINSPGGSVTAGMAIYDT 80  Haemophilus influenza...
P80244   1 MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDT 80  Bacillus subtilis sub...
P56156   2 MGYIPYVIENTDRGERSYDIYSRLLKDRIVLLSGEINDSVASSIVAQLLFLEAEDPEKDIGLYINSPGGVITSGLSIYDT 81  Helicobacter pylori 2...
P54416   1 --MIPTVIETSGRGDRAFDIYSRLLRERIVFLGQEVRDENANLVVAQLLFLEAEDPEKDIYLYINSPGGSVSAGLGIFDT 78  Synechocystis sp. PCC...
Q59993  21 QSVVPMVVEQSGMGERAFDIYSRLLRERIIFLGTPVDDQVADSIVAQLLFLDAEDPEKDIQLYINSPGGSVYAGLAIYDT 100 Synechocystis sp. PCC...
O51556   2 HNLIPTVIENTGNYERVFDIYSRLLRERIIFLSGEINDPKADTVIAQLLFLESEDSSKDIYLYLNSPGGSITAGLAIYDT 81  Borrelia burgdorferi B31
P19245  14 MALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDT 93  Escherichia coli
2ZL0_A   2 MGYIPYVIENTDRGERSYDIYSRLLKDRIVLLSGEINDSVASSIVAQLLFLEAEDPEKDIGLYINSPGGVITSGLSIYDT 81  Helicobacter pylori 2...
3TT7_A   1 MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDT 80  Bacillus subtilis sub...
3MT6_R  94 MQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQ 173 Escherichia coli ATCC...
P43867  81 MQFIKPDIRTLCIGQACSMGAFLLAGGTAGKRAALPNARVMIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQ 160 Haemophilus influenza...
P80244  81 MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ 160 Bacillus subtilis sub...
P56156  82 MNFIRPDVSTICIGQAASMGAFLLSCGAKGKRFSLPHSRIMIHQPLGGAQGQASDIEIISNEILRLKGLMNSILAQNSGQ 161 Helicobacter pylori 2...
P54416  79 MNQIRPDVCTICIGLAASMGAFLLSAGAKGKRMSLPNSRIMIHQPLGGAQGQATDIEIQAKEILYLKALLNQHLANHTGK 158 Synechocystis sp. PCC...
Q59993 101 MQQIRPDVVTICFGLAASMGAFLLSGGCKGKRMALPSSRIMIHQPLGGAQGQAVEIEIQAREILYIKDRLNTMLVEHTGQ 180 Synechocystis sp. PCC...
O51556  82 MQYIKPDVRTICIGQAASMGAFLLAGGAKGKRESLTYSRIMIHQPWGGISGQASDINIQANEILRLKKLIIDIMSNQIGV 161 Borrelia burgdorferi B31
P19245  94 MQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQ 173 Escherichia coli
2ZL0_A  82 MNFIRPDVSTICIGQAASMGAFLLSCGAKGKRFSLPHSRIMIHQPLGGAQGQASDIEIISNEILRLKGLMNSILAQNSGQ 161 Helicobacter pylori 2...
3TT7_A  81 MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ 160 Bacillus subtilis sub...
3MT6_R 174 SLEQIERDTERDRFLSAPEAVEYGLVDSILTH 205 Escherichia coli ATCC 8739
P43867 161 GIERIEKDTDRDNFMSAEEAQAYGLVDEVLVK 192 Haemophilus influenzae Rd KW20
P80244 161 PLEVIERDTDRDNFKSAEEALEYGLIDKILTH 192 Bacillus subtilis subsp. subtilis str. 168
P56156 162 SLEQIAKDTDRDFYMSAKEAKEYGLIDKVLQK 193 Helicobacter pylori 26695
P54416 159 SLEEITADTERDFFMSAEESKEYGLIDQVINR 190 Synechocystis sp. PCC 6803 substr. Kazusa
Q59993 181 PMEKLQEDTERDFFMSAEEAKEYGLIDQVISR 212 Synechocystis sp. PCC 6803 substr. Kazusa
O51556 162 DKEKLALDMERDYFMTSSDALKYGLIDSILVR 193 Borrelia burgdorferi B31
P19245 174 SLEQIERDTERDRFLSAPEAVEYGLVDSILTH 205 Escherichia coli
2ZL0_A 162 SLEQIAKDTDRDFYMSAKEAKEYGLIDKVLQK 193 Helicobacter pylori 26695
3TT7_A 161 PLEVIERDTDRDNFKSAEEALEYGLIDKILTH 192 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap