2VHL


Conserved Protein Domain Family
nagA

?
TIGR00221: nagA 
Click on image for an interactive view with Cn3D
N-acetylglucosamine-6-phosphate deacetylase
[Central intermediary metabolism, Amino sugars]
Statistics
?
PSSM-Id: 272968
View PSSM: TIGR00221
Aligned: 5 rows
Threshold Bit Score: 596.045
Threshold Setting Gi: 1171640
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2VHL_A         4 SLLIKDIAIVTENEVIKNGYVGINDGKISTVSTERPKE----PYSKEIQAPAdSVLLPGMIDIHIHGGYGADTMD--ASF 77
gi 127800      1 MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELP----PEIEQRSLNG-AILSPGFIDVQLNGCGGVQFNDtaEAV 75
gi 1171640     2 KYALINCVIYTKYDVLRDFAVIINGEIIEAVIPQAELE----TGIKTIDLQG-NNLTAGFIDLQLNGCGGVMFND--QTS 74
gi 499192154   4 FCLFNSKSVLTGNDKIDNSAVLIKDNKIFDIVTSDRLKkmdlEEYQMIDTKG-NYITPGLYDNHIHGFHGHGTDQ--CST 80
gi 3122425     4 SLLIKDIAIVTENEVIKNGYVGINDGKISTVSTERPKE----PYSKEIQAPAdSVLLPGMIDIHIHGGYGADTMD--ASF 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2VHL_A        78 --STLDIMSSRLPEEGTTSFLATTITQEHGNISQALVNAREWKAAEEssllGa----ELLGIHLEGPFVSPKRAGAQPKE 151
gi 127800     76 svETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHP----N-----QALGLHLEGPWLNLVKKGTHNPN 146
gi 1171640    75 v-ETLEIMQETNLKSGCTSFLPTFITAPDENIKSAVKIMREYLNKHK----N-----QALGLHIEGPYLSIEKKGVHRPE 144
gi 499192154  81 --ESILKMSEHLAQYGVVGFLPTLYPRPIDEMIKTIKACIAAIGKEK----Ga----KILGLHLEGPFFSPEKKGAHPVS 150
gi 3122425    78 --STLDIMSSRLPEEGTTSFLATTITQEHGNISQALVNAREWKAAEE----SsllgaELLGIHLEGPFVSPKRAGAQPKE 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2VHL_A       152 WIRPSDVELfKKWQQEAGG-----------LIKIVTLAPeEDQHFELIRHLKDESIIASMGHTDADSALLSDAAKAGASH 220
gi 127800    147 FVRKPDAAL-VDFLCENAD-----------VITKVTLAP-EMVPAEVISKLANAGIVVSAGHSNATLKEAKAGFRAGITF 213
gi 1171640   145 YIREITPEM-KDFLCENGD-----------VITKMTIAA-ENPTINYTPDFVKAGIIVSVGHSNATYEVAKAAFHKGATF 211
gi 499192154 151 YLHEPSIEVmQKLIDAAGGvftgsngkrktHISTMTVAPeLKGMRELAIFCLENNINLQAGHTNATYENMIEGFQVGILH 230
gi 3122425   152 WIRPSDVELfKKWQQEAGG-----------LIKIVTLAPeEDQHFELIRHLKDESIIASMGHTDADSALLSDAAKAGASH 220
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2VHL_A       221 MTHLYNAMSPFH-HREPGVIGTALAHDGFVTELIADGIHSHPLAAKLAFLAKGSsKLILITDSMRAKGLK--DGVYEFGG 297
gi 127800    214 ATHLYNAMPYIT-GREPGLAGAILDEADIYCGIIADGLHVDYANIRNAKRLKGD-KLCLVTDATAPAGAN--IEQFIFAG 289
gi 1171640   212 ATHLHNAMSPISsGREMGVVGAVLDS-DVYTGIIVDGVHINYGNVRIDKKIKGD-KLCIVTDSIAAAGAPpeLESFTFVG 289
gi 499192154 231 TTHFFNAMSKLD-HRNPNAIGAVLIHGDVSCEIIADGHHIHPKLILMLRKLKDIsKIVLVTDGLTPNCQT--CGKLIANG 307
gi 3122425   221 MTHLYNAMSPFH-HREPGVIGTALAHDGFVTELIADGIHSHPLAAKLAFLAKGSsKLILITDSMRAKGLK--DGVYEFGG 297
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2VHL_A       298 QSVTVRGRTALL--SDGTLAGSILKMNEGARHMREFTNCSWTDIANITSENAAKQLGIFDRKGSVTVGKDADLVIVSSDC 375
gi 127800    290 KTIYYRNGLCVD--ENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPDF 367
gi 1171640   290 KTIYIKEGRCYD--ANDTIAGASITMMESIKNAVEYVEIPLAEAIRMSNLYPARAIGIDDRLGSVEKGKIANLAVFTPNY 367
gi 499192154 308 DEVYIAEDGLFHsvKSNTIAGSTLTMIQGLKNLIEFG-FSLSDAVQASSYNPTRILNIDKK-GLICHGYDANLNVLDKDF 385
gi 3122425   298 QSVTVRGRTALL--SDGTLAGSILKMNEGARHMREFTNCSWTDIANITSENAAKQLGIFDRKGSVTVGKDADLVIVSSDC 375
                        410
                 ....*....|
2VHL_A       376 EVILTICRGN 385
gi 127800    368 KITKTIVNGN 377
gi 1171640   368 QVIGTVVNGK 377
gi 499192154 386 NLKLTMIESK 395
gi 3122425   376 EVILTICRGN 385
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap