2WW4


Conserved Protein Domain Family
ispE

?
TIGR00154: ispE 
Click on image for an interactive view with Cn3D
4-diphosphocytidyl-2C-methyl-D-erythritol kinase
Members of this family of GHMP kinases were previously designated as conserved hypothetical protein YchB or as isopentenyl monophosphate kinase. It is now known, in tomato and E. coli, to encode 4-diphosphocytidyl-2C-methyl-D-erythritol kinase, an enzyme of the deoxyxylulose phosphate pathway of terpenoid biosynthesis. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 188029
View PSSM: TIGR00154
Aligned: 6 rows
Threshold Bit Score: 362.984
Threshold Setting Gi: 6919910
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WW4_A   1 MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRD-DGDIRLLTPVEGVEHED-NLIVRAARLLMKTA 78  Shigella boydii CDC 3...
P37550   1 MRILEKAPAKINLSLDVTRKRPDGYHEVEMIMTTIDLADRIELTELA-EDEVRVSSHNRFVPDDQrNLAYQAAKLIKDRY 79  Bacillus subtilis sub...
P24209   1 MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRD-DGDIRLLTPVEGVEHED-NLIVRAARLLMKTA 78  Escherichia coli
P45271  20 QPLRFPSPAKLNLFLYINGKFPNGYHELQTLFQFLDFGDWLDISIREqDNQIVLTPEIPNLKTEN-NLIYRAAKLLQEKA 98  Haemophilus influenza...
O25984   1 MTHVFEVYPKVNIFLKILHK-EGAYHKLISRMCLVKDKLKDIISVKS--ALSFSLKGDFDCPLEE-NSLFKALQILKNFL 76  Helicobacter pylori 2...
P72663   2 HSYTLHAPAKINLFLEILGDRPDGFHELVMVLQSIALGDKITVRANG-TDDIRLSCGDSPLANDAtNLAYRAAQLMINNF 80  Synechocystis sp. PCC...
2WW4_A  79 Adsg----rlpTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRG-HAAFA 153 Shigella boydii CDC 3...
P37550  80 N----------VKKGVSIMITKVIPVAAGLAGGSSDAAATLRGLNRLWNLNLSAETLAELGAEIGSDVSFCVYG-GTALA 148 Bacillus subtilis sub...
P24209  79 Adsg----rlpTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRG-HAAFA 153 Escherichia coli
P45271  99 N----------IQLGANIHLDKILPMGGGVGGGSSNAATALVSLNYLWQANLSIDELAKLGLTLGADVPIFVHG-HAAFA 167 Haemophilus influenza...
O25984  77 KsknfshsvikSLDTLAIEVEKNIPTQAGLGGGSTDAGGLLYHLNQIFDWRLSLEELYSMGSLVGADTNFFISQyKSTNA 156 Helicobacter pylori 2...
P72663  81 Pqa------hdNYGGVDITLTKHIPMAAGLAGGSADAAAVLVGLDLLWNLGLTRPELEQLAAQLGSDIPFCIGG-GTAIA 153 Synechocystis sp. PCC...
2WW4_A 154 EGVGEILTPV--DPPEKWYLVAHP-GVSIPTPVIFKDPE-------LPRNTPKRS-----------------IETLLKCE 206 Shigella boydii CDC 3...
P37550 149 TGRGEKIKHIs-TPPHCWVILAKP-TIGVSTAEVYRALK-------LDGIEHPDVqgmie-------aieekSFQKMCSR 212 Bacillus subtilis sub...
P24209 154 EGVGEILTPV--DPPEKWYLVAHP-GVSIPTPVIFKDPE-------LPRNTPKRS-----------------IETLLKCE 206 Escherichia coli
P45271 168 EGVGEKITYC--EPAEKWFVILKP-DDSISTAVIFQDPN-------LPRNTPKKS-----------------LAQLLSEP 220 Haemophilus influenza...
O25984 157 TSYGEVIENFeeEPLENRLEIYAPnHVFCSTKAVYQAYK--------PETCFSQAkewlk-------kpsleCLKTYDRN 221 Helicobacter pylori 2...
P72663 154 TGRGEILDPLp-DGNCFWVVLAKHrSIEVSTPWAYQTYRqkfgknyLNDDQSQRArrktihagpllqgiqhrNPGQIASH 232 Synechocystis sp. PCC...
2WW4_A 207 FSNDCEVIARKRFREVDAVLSWLLEY--APSR-LTGTGACVFAEFDTESEARQVLEqapeWLNGFVAKGVNLSPLHRAML 283 Shigella boydii CDC 3...
P37550 213 LGNVLESVTLDMHPEVAMIKNQMKRFgaDAVL-MSGSGPTVFGLVQYESKVQRIYN----GLRGFCDQVYAVRMIGEQNA 287 Bacillus subtilis sub...
P24209 207 FSNDCEVIARKRFREVDAVLSWLLEY--APSR-LTGTGACVFAEFDTESEARQVLEqapeWLNGFVAKGANLSPLHRAML 283 Escherichia coli
P45271 221 YKNDCEKVVINHYSNVEKALNWLLQY--APAR-LTGTGACVFAEFDHEAEAQAVFRqkpeAFFGFVAKGLNVSPLHAMLK 297 Haemophilus influenza...
O25984 222 GLNDLLKPAL--LTN--QALKDI-ESelGKEWfFSGSGSAFFRLKPMQKGGE---------------------------- 268 Helicobacter pylori 2...
P72663 233 IHNDLEKVVLPAHQPVAQLRQVLQSAggLGTM-MSGSGPSVFTLCREQAEAEQVLAiakeKLNDPDVDFWLTHTIGHGIQ 311 Synechocystis sp. PCC...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap