Conserved Protein Domain Family
beta_RFAP_syn

?
TIGR00144: beta_RFAP_syn 
beta-RFAP synthase
This protein family contains several archaeal examples of beta-ribofuranosylaminobenzene 5-prime-phosphate synthase (beta-RFAP synthase), an enzyme involved in methanopterin biosynthesis. In some species, two members of this family are found. It is unclear whether both act as beta-RFAP synthase. This family is related to the GHMP kinases (Galactokinase, Homoserine kinase, Mevalonate kinase, Phosphomevalonate kinase). Members are found so far only in the Archaea and in Methylobacterium extorquens. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 129249
View PSSM: TIGR00144
Aligned: 3 rows
Threshold Bit Score: 502.094
Threshold Setting Gi: 3183231
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58822   1 MIIQTPSRIHMGLIDLNGSIGRVDGGIGLALEEPNIKIEGKESDdisiefdkKLIEKyGEDYIksvRDRVYNTAIKVLDV 80  Methanocaldococcus ja...
O28190   2 LRLRTPSRIHITLIDLNGSIGRVDGGVGLALEEPHIEIKAKESE--------TFVLK-GEPIN---RERFEIAAAKMAEY 69  Archaeoglobus fulgidu...
O26918   5 LIINTPSRLHLTLIDLNGERGRLDGGVGITLNEPELVVGLEASDdmgveftsHAEGKlREEYR----SKIMEAARRTLKH 80  Methanothermobacter t...
Q58822  81 IGg-EGVDLKILSLFPAHSGLGSGTQLSLAVGKLISKIYNKEMNAYNIAKITGRGGTSGIGIGAFEYGGFLIDGGHSFgk 159 Methanocaldococcus ja...
O28190  70 CG--RGAEIEVVSDYDAHVGLGSGTQISLAVGRAFSELYGLNLTTRQIAEIMGRGGTSGIGVAVFDHGGLVVDGGHST-- 145 Archaeoglobus fulgidu...
O26918  81 IGsdEKFHFTVRSMFPAHSGLGSGTQLSLATARLVAEYHGMKFTARELAHIVGRGGTSGIGVASFEDGGFIVDAGHSS-- 158 Methanothermobacter t...
Q58822 160 gKDKEDFRPSSASKgVKPAPIIFRHDF--DWETILIIPKGE-HVYGKKEVDIFKKYCPVPLNEVEKICHLVLMKMMPAVV 236 Methanocaldococcus ja...
O28190 146 -KEKKSFLPSSASR-AKPAPMIARLDFp-DWNVVLAIPDLK-GFFGEREVNLFQKSCPVPLEDVREICHLILMKMLPAVV 221 Archaeoglobus fulgidu...
O26918 159 -REKSDFLPSSASS-ASPPPVIARYDFpeEWNIIIAIPEIDrSVSGRREVNIFQEYCPLPLRDVERLSHIILMKMMPAIL 236 Methanothermobacter t...
Q58822 237 EKNLDDFGEVINKLQYLGFKKVELSLQSDIVKDLINELHkd--vYAGLSSFGPTIYAFGDK--KLIVEKANDIFDKYGVY 312 Methanocaldococcus ja...
O28190 222 EADLDEFGKALKRIQELGFKKAEVEQYGELIKGCFDLAD-----CIGMSSTGPTVYAITDSnaGGIERSLRDYFAEKGYE 296 Archaeoglobus fulgidu...
O26918 237 EGDIEAFGESVNEIQGTGFKRIERELQDPLIDRIIDSMIsagapGAGMSSFGPAVYSVTDEkpGNVAGAVAEIMGP---- 312 Methanothermobacter t...
Q58822 313 GEIIITKANNVGHKIW 328 Methanocaldococcus jannaschii DSM 2661
O28190 297 CRTIVTKARNRGVEIE 312 Archaeoglobus fulgidus DSM 4304
O26918 313 GRIIVTGGRNRGAFMI 328 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap