2AJ4


Conserved Protein Domain Family
gal_kin

?
TIGR00131: gal_kin 
Click on image for an interactive view with Cn3D
galactokinase
Galactokinase is a member of the GHMP kinases (Galactokinase, Homoserine kinase, Mevalonate kinase, Phosphomevalonate kinase) and shares with them an amino-terminal domain probably related to ATP binding.The galactokinases found by this model are divided into two sets. Prokaryotic forms are generally shorter. The eukaryotic forms are longer because of additional central regions and in some cases are known to be bifunctional, with regulatory activities that are independent of galactokinase activity. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 272924
View PSSM: TIGR00131
Aligned: 6 rows
Threshold Bit Score: 566.761
Threshold Setting Gi: 1346086
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AJ4_A        49 CPSIIKKFISAYDAKPDFVAR-SPGRVNLIGEHIDYCDFSVLPLAIDFDMLCAVKVLNEKNPSITLINADP-KFAQRKFD 126 baker's yeast
P39574         2 REELKGIFASVFGEKEGLRFFfAPGRVNLIGEHTDYNGGHVFPCALTMGTYAAVAERNDGLVRMYSDNFRNaGIKECSLD 81  Bacillus subtil...
P13045        23 HLAVVDAFFQTYHVKPDFIAR-SPGRVNLIGEHIDYCDFSVLPLAIDVDMLCAVKILDEKNPSITLTNADP-KFAQRKFD 100 Saccharomyces c...
WP_000053415   4 KEKTQSLFANAFGYPATHTIQ-APGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDDRKVRVMAADYEN-QLDEFSLD 81  Enterobacteriaceae
WP_010869061   4 IQNAQQIFNRQHKNLPEITVY-APGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLD--ETDEFSLN 80  Haemophilus inf...
CAA53677      29 CPSIIKKFISAYDAKPDFVAR-SPGRVNLIGEHIDYCDFSVLPLAIDFDMLCAVKVLNEKNPSITLINADP-KFAQRKFD 106 baker's yeast
2AJ4_A       127 LPLDGSYvtidpsvSDWSNYFKCGLHVAHsflkklapERFASAPLaGLQVFCEGDVPTGSGLSSSAAFICAVAlAVVKaN 206 baker's yeast
P39574        82 DIRYQKE-------DDWANYPKGVIYEFQ--------QRGYAVPH-GFDIVFSGNIPNGAGLSSSASIELLMG-VVLQ-S 143 Bacillus subtil...
P13045       101 LPLDGSYmaidpsvSEWSNYFKCGLHVAHsylkkiapERFNNTPLvGAQIFCQSDIPTGGGLSS--AFTCAAAlATIRaN 178 Saccharomyces c...
WP_000053415  82 APIVAHEn------YQWANYVRGVVKHLQ--------LRNNSFG--GVDMVISGNVPQGAGLSSSASLEVAVG-TVLQ-Q 143 Enterobacteriaceae
WP_010869061  81 VEIPKSE-------HKWANYVRGVVKFIQ--------ERYPDFQQ-GANLVISGNVPLSSGLSSSAALEVAVG-KFCQ-Q 142 Haemophilus inf...
CAA53677     107 LPLDGSYvtidpsvSDWSNYFKCGLHVAHsflkklapERFASAPLaGLQVFCEGDVPTGSGLSSSAAFICAVAlAVVKaN 186 baker's yeast
2AJ4_A       207 MGPGYHMSKQNLMRITVVAEHYVGVNNGGMDQAASVCGEEDHALYVEFKpQLKATPFKFPQLknhEISFVIANTLVVSNk 286 baker's yeast
P39574       144 YFHPEVDALELVKMAQHAENHFIGVNCGIMDQFAIGMGKKHHAMLLNCD-TLDYEYSKLNVS---GLALVIANTNKKRT- 218 Bacillus subtil...
P13045       179 MGKNFDISKKDLTRITAVAEHYVGVNNGGMDQATSVYGEEDHALYVEFRpKLKATPFKFPQLknhEISFVIANTLVKSNk 258 Saccharomyces c...
WP_000053415 144 LYHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALGKKDHALLIDCR-SLGTKAVSMPK----GVAVVIINSNFKRT- 217 Enterobacteriaceae
WP_010869061 143 LGDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCR-SLETTPTPVPQ----DVAVIIVNSNVPHD- 216 Haemophilus inf...
CAA53677     187 MGPGYHMSKQNLMRITVVAEHYVGVNNGGMDQAASVCGEEDHALYVEFKpQLKATPFKFPQLknhEISFVIANTLVVSNk 266 baker's yeast
2AJ4_A       287 feTAPTNYNLRVVEVTTAANVLAATygvvllsgkegsstnKGNLRDFMNVYYAryhnistpwngdiesgiERLTKMLVLV 366 baker's yeast
P39574       219 --LADSSYNTRRQECNDALLDLKKGl-------------dIAALGDIKPSDFD-----------------AHSSLIQNET 266 Bacillus subtil...
P13045       259 feTAPTNYNLRVIEVTVAANALATRysvalpshkdnsnseRGNLRDFMDAYYAryenqaqpwngdigtgiERLLKMLQLV 338 Saccharomyces c...
WP_000053415 218 --LVGSEYNTRREQCETGARFFQQP-----------------ALRDVTIEEFN-----------------AVAHELDPIV 261 Enterobacteriaceae
WP_010869061 217 --LVTGEYNTRRQQCEEAAKFFGVK-----------------ALRDVSVEQFQkr--------------eAELTALSPLA 263 Haemophilus inf...
CAA53677     267 feTAPTNYNLRVVEVTTAANVLAATygvvllsgkegsstnKGNLRDFMNVYYAryhnistpwngdiesgiERLTKMLVLV 346 baker's yeast
2AJ4_A       367 EEslankkqgfsvddvaqslncsreeftrdylttspvrfqvlklyqRAKHVYSESLRVLKAVKLMTtasftaDEDfFKQF 446 baker's yeast
P39574       267 NRr-------------------------------------------RAKHAVYENHRAIKTAHMFK------ENN-IDEI 296 Bacillus subtil...
P13045       339 EEsfsrkksgftvheastalncsreeftrdylttfpvrfqvlklyqRAKHVYSESLRVLKALKMMTsatfhtDEDfFTDF 418 Saccharomyces c...
WP_000053415 262 AK--------------------------------------------RVRHILTENARTVEAASALE------QGD-LKRM 290 Enterobacteriaceae
WP_010869061 264 AK--------------------------------------------RARHVVTENQRVLDAVEALK------NND-LTCL 292 Haemophilus inf...
CAA53677     347 EEslankkqgfsvddvaqslncsreeftrdylttspvrfqvlklyqRAKHVYSESLRVLKAVKLMTtasftaDEDfFKQF 426 baker's yeast
2AJ4_A       447 GALMNESQASCDKLYECSCPEID-KICSIALSNG-SYGSRLTGAGWGGCTVHLVpggP---NGNIEKVKEALANefykvK 521 baker's yeast
P39574       297 GQLMKESHLSLKDDYEVTCPELDeLVFAAWDHEG-VIGSRMTGAGFGGCTISIV---K---DEFVDDFIQKVGD-----R 364 Bacillus subtil...
P13045       419 GRLMNESQASCDKLYECSCIETN-QICSIALANG-SFGSRLTGAGWGGCTIHLV---PsgaNGNVEQVRKALIE-----K 488 Saccharomyces c...
WP_000053415 291 GELMAESHASMRDDFEITVPQIDtLVEIVKAVIGdKGGVRMTGGGFGGCIVALI---P---EELVPAVQQAVAE-----Q 359 Enterobacteriaceae
WP_010869061 293 GKLMEASHDSMRDDFEITVPQIDyLVELAQLVIGkSGGARMTGGGFGGCIVALA---P---HDKVDSVRKIIAD-----N 361 Haemophilus inf...
CAA53677     427 GALMNESQASCDKLYECSCPEID-KICSIALSNG-SYGSRLTGAGWGGCTVHLV---PggpNGNIEKVKEALAN-----E 496 baker's yeast
2AJ4_A       522 -----YPKITDAELENAIIVSKPALGSC 544 baker's yeast
P39574       365 -----YQEKTGLRADFYVADIGEGAREL 387 Bacillus subtilis subsp. subtilis str. 168
P13045       489 fynvrYPDLTDEELKDAIIVSKPALGTC 516 Saccharomyces cerevisiae S288c
WP_000053415 360 -----YEAKTGIKETFYVCKPSQGAGQC 382 Enterobacteriaceae
WP_010869061 362 -----YEKTTGLKETFYVCTASQGVRVI 384 Haemophilus influenzae
CAA53677     497 fykvkYPKITDAELENAIIVSKPALGSC 524 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap