1ARZ


Conserved Protein Domain Family
dapB

?
TIGR00036: dapB 
Click on image for an interactive view with Cn3D
4-hydroxy-tetrahydrodipicolinate reductase
[Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 129147
View PSSM: TIGR00036
Aligned: 9 rows
Threshold Bit Score: 342.082
Threshold Setting Gi: 2498288
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ARZ_A   5 NIRVAIAGAGGRMGRQLIQAALAL-EGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAV------KDDFDVFI 77  Escherichia coli BW2952
P04036   5 NIRVAIAGAGGRMGRQLIQAALAL-EGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAV------KDDFDVFI 77  Escherichia coli K-12
P45153   2 TLKIAIAGAGGRMGCQLIQAVHSA-EGVELGAAFERKGSSLVGTDAGELAGIGHLGVAVSDDLESQ------KDKFDLLI 74  Haemophilus influenza...
O29353   1 -MRVAVSGAAGRMGRLVVKNAVA--EGLKVVQAFD---INEVGKDAGELAGVGKIGVPIEDDIS--------KLDADVLI 66  Archaeoglobus fulgidu...
P94844   1 -MKIGVYGASGRIGKLLLEELKGGyKGLALSSVFVR---QKCETD---FSSFSHAPL-VTNDLKAF------VRACECVI 66  Helicobacter pylori 2...
P72642   6 LIPVVVNGAAGKMGREVIKAVAQA-PDLQLVGAVD-HNPSLQGQDIGEVVGIAPLEVPVLADLQSVlvlatqEKIQGVMV 83  Synechocystis sp. PCC...
P42976   5 TIKLVIAGPRGRMGQEAVKLAERT-PHFDLVGAID-HTYDQQ-----KLSDVMPVES--DAFIYTDihacftETQPDVLI 75  Bacillus subtilis sub...
Q57865   1 MIKVAVTGALGRMGSNIIKTITQQ-EDMKVVCAFEVPNHPKKGEDVGELIGIGKIGVPLSTADELDkv--lkETKPDVLV 77  Methanocaldococcus ja...
O26891   1 MIRVAVTGACGRMGSGIIRRVLEE-EDMELVAAIEAPGTPLRGRDIGEFTGRGSVGVEVTDASNLAdt--laETEPDVLV 77  Methanothermobacter t...
1ARZ_A  78 DFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQ--AIRDAAadIAIVFAANFSVGVNVMLKLLEKAAKVMGDYtDIEI 155 Escherichia coli BW2952
P04036  78 DFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQaiRDAAAD--IAIVFAANFSVGVNVMLKLLEKAAKVMGDYtDIEI 155 Escherichia coli K-12
P45153  75 DFTRPEGTLEHIAFCVANNKKMVIGTTGFDENGKVaiKAASDK--IAIVFASNFSVGVNLVFKLLEKAAKVMGDYcDIEV 152 Haemophilus influenza...
O29353  67 DFTTAEAAMKNAEVAAEKGVRVVMGTTGFTDEDRKrlAELAEK--VPMIVSPNFSLGVNIFWKIVEYAAKMLYEW-DAEI 143 Archaeoglobus fulgidu...
P94844  67 DFSLPKGVDNLLEALLECPKILVSGTTGLEKETLEkmQQLALK--APLLHAHNMSIGIMMLNQLAFLTSLKLKDA-DIEI 143 Helicobacter pylori 2...
P72642  84 DFTHPSGVYDNVRSAIAYGVRPVVGTTGLSEQQIQdlGDFAEKasTGCLIAPNFAIGVLLMQQAAVQACQYFDHV---EI 160 Synechocystis sp. PCC...
P42976  76 DLTTPEIGKVHTKIALEHGVRPVVGTTGFSEADLKelTSLTEEkgIGAIIAPNFALGAILMMKFSKMAANYFEDV---EI 152 Bacillus subtilis sub...
Q57865  78 DFTIAHACVENVKIAAKNGVNLVIGTTGFTEEQKAeiEKAIKEnnVAAVISQNFAIGVNIFFKTLEFLAKKLGDY-DIEI 156 Methanocaldococcus ja...
O26891  78 DFTVASAAVETIKTSTEAGVNLVVGTTGFSEEEMQtvRDCIERsgVRAVIAPNMAVGVNVFFKVLRDLAPILSDY-DVEI 156 Methanothermobacter t...
1ARZ_A 156 IEAHHRHKVDAPSGTALAMGEAIAHALDkD-LKDCAVYSREGHTGERVPGTIG---FATVRAGDIVGEHTAMFADIGERL 231 Escherichia coli BW2952
P04036 156 IEAHHRHKVDAPSGTALAMGEAIAHALD-KdLKDCAVYSREGHTGERVPGTIG---FATVRAGDIVGEHTAMFADIGERL 231 Escherichia coli K-12
P45153 153 IEAHHRHKVDAPSGTALSMGEHIAKTLG-RdLKTHGVFCREGITGERKRDEIG---FSTIRASDVVGEHSVWFADIGERV 228 Haemophilus influenza...
O29353 144 VELHHRHKRDSPSGTALKLAEIIRKVKEeKgIEADLKTCREGIS-PR-ESEIG---VFGIRGGDVVGEHTVFFFGSGERI 218 Archaeoglobus fulgidu...
P94844 144 IETHHNLKKDIPSGTALSLYETCAKARG-YdEKNALITHREGLR-SK--ESIG---IAALRGGDVAGKHTIGFYLEGEYI 216 Helicobacter pylori 2...
P72642 161 IELHHNQKADAPSGTAIKTAQMLAEMGKt--FNPPAVEEKETIAGAKGGLGPGqipIHSIRLPGLIAHQEVLFGSPGQLY 238 Synechocystis sp. PCC...
P42976 153 IELHHDQKLDAPSGTALKTAEMISEVRKe--KQQGHPDEKEILPGARGAEQNGi-rLHSVRLPGLIAHQEVMFGMDGQTL 229 Bacillus subtilis sub...
Q57865 157 IEMHHRYKKDAPSGTALRAAEIIKANRG---IESVFVYGRYGMTGERKKEEIG---IHALRGGDVVGDHTVIFAGDGERI 230 Methanocaldococcus ja...
O26891 157 IEAHHRHKKDAPSGTAVRALEVISEATGrR-ASEVAVHGRSGLTGERSRDEIG---VHAVRGGDIVGDHIVLFAGDGERL 232 Methanothermobacter t...
1ARZ_A 232 EITHKASSRMTFANGAVRSALWLSGKES-GLFDMRDVLD 269 Escherichia coli BW2952
P04036 232 EITHKASSRMTFANGAVRSALWLSGKES-GLFDMRDVLD 269 Escherichia coli K-12
P45153 229 EISHKASSRMTFANGAVRAGKWLENKAN-GLFDMTDVLD 266 Haemophilus influenzae Rd KW20
O29353 219 ELTHRAMSRECFAIGAVRAAKWIAKVDKpGFYTMDDFLE 257 Archaeoglobus fulgidus DSM 4304
P94844 217 ELSHTATNRSIFAKGALEVALWLKDKAA-KKYEINEMFG 254 Helicobacter pylori 26695
P72642 239 TIRHDTTDRACYMPGVLLGIRKVVELKG-LVYGLEKLL- 275 Synechocystis sp. PCC 6803 substr. Kazusa
P42976 230 QIRHDSYNRASFMSGVKLSVEQVMKIDQ-LVYGLENIID 267 Bacillus subtilis subsp. subtilis str. 168
Q57865 231 ELTHRASSRQAFVNGVILAIRYIADKKEg-IYNTFDVLG 268 Methanocaldococcus jannaschii DSM 2661
O26891 233 EIVHRAHSRDAFIGGVIRAIRFIEDAEPgRIMDMGDVLG 271 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap