Conserved Protein Domain Family
PTZ00336

?
PTZ00336: PTZ00336 (this model, PSSM-Id:140357 is obsolete)
elongation factor 1-alpha; Provisional
Statistics
?
PSSM-Id: 140357
View PSSM: PTZ00336
Aligned: 17 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 18-Mar-2009
Updated: 1-May-2009
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71408910    8 MNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVLDKLKAERERGITIDIALWKFESPKSVF 87
gi 71403912    1 MNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVLDKLKAERERGITIDIALWKFESPKSVF 80
gi 71403914    8 MNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVLDKLKAERERGITIDIALWKFESPKSVF 87
gi 71664927    8 MNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVLDKLKAERERGITIDIALWKFESPKSVF 87
gi 71664929    8 MNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKSSFKYAWVLDKLKAERERGITIDIALWKFESPKSVF 87
gi 71746820    8 MNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAADIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVF 87
gi 154335074   8 MNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEMGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVF 87
gi 146083153   8 MNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVF 87
gi 146083157   8 MNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVF 87
gi 157867418   8 MNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVF 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71408910   88 TIIDAPGHRDFIKNMITGTSQADAAVLVIASSQGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERY 167
gi 71403912   81 TIIDAPGHRDFIKNMITGTSQADAAVLVIASSQGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERY 160
gi 71403914   88 TIIDAPGHRDFIKNMITGTSQADAAVLVIASSQGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERY 167
gi 71664927   88 TIIDAPGHRDFIKNMITGTSQADAAVLVIASSQGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERY 167
gi 71664929   88 TIIDAPGHRDFIKNMITGTSQADAAVLVIASSQGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKSVNFAQERY 167
gi 71746820   88 TIIDAPGHRDFIKNMITGTSQADAAILIIASAQGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVNYGQERY 167
gi 154335074  88 TIIDAPGHRDFIKNMITGTSQADAAILMIDSTQGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVQYSQARY 167
gi 146083153  88 TIIDAPGHRDFIKNMITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVTYAQSRY 167
gi 146083157  88 TIIDAPGHRDFIKNMITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVTYAQSRY 167
gi 157867418  88 TIIDAPGHRDFIKNMITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVTYAQSRY 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71408910  168 DEIVKEVSAYLKKVGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGGI 247
gi 71403912  161 DEIVKEVSAYLKKVGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGGI 240
gi 71403914  168 DEIVKEVSAYLKKVGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGGI 247
gi 71664927  168 DEIVKEVSAYLKKVGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGGI 247
gi 71664929  168 DEIVKEVSAYLKKVGYNVEKVRFIPISGWQGDNMIDKSENMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGGI 247
gi 71746820  168 DEIVKEVSAYIKKVGYNVEKVRFVPISGWQGDNMIEKSEKMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGGI 247
gi 154335074 168 EEISKEVGTYLKRVGYNPEKVRFIPISGWQGDNMIDKSESMAWYKGPTLLDALDMLEAPVRPVDKPLRLPLQDVYKIGGI 247
gi 146083153 168 DEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIERSDNMPWYKGPTLLDALDMLEPPVRPVDKPLRLPLQDVYKIGGI 247
gi 146083157 168 DEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIERSDNMPWYKGPTLLDALDMLEPPVRPVDKPLRLPLQDVYKIGGI 247
gi 157867418 168 DEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLDALDMLEPPVRPVDKPLRLPLQDVYKIGGI 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71408910  248 GTVPVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAAD 327
gi 71403912  241 GTVPVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLVEATPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAAD 320
gi 71403914  248 GTVPVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLVEATPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAAD 327
gi 71664927  248 GTVPVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAAD 327
gi 71664929  248 GTVPVGRVETGTMKPGDVVTFAPANVTTEVKSIEMHHEQLVEATPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAAD 327
gi 71746820  248 GTVPVGRVETGVMKPGDVVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRRGNVCGNTKNDPPKEAAD 327
gi 154335074 248 GTVPVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAVPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAAD 327
gi 146083153 248 GTVPVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAAD 327
gi 146083157 248 GTVPVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAAD 327
gi 157867418 248 GTVPVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAAD 327
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71408910  328 FTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRRSGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYA 407
gi 71403912  321 FTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRRSGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYA 400
gi 71403914  328 FTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRRSGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYA 407
gi 71664927  328 FTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRRSGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYA 407
gi 71664929  328 FTAQVIILNHPGQIGNGYAPVLDCHTCHIACKFAEIESKIDRRSGKELEKNPKSIKSGDAAMVRMVPQKPMCVEVFNDYA 407
gi 71746820  328 FTAQVIILNHPGQIGNGYAPVLDCHTSHIACKFAEIESKIDRRSGKELEKAPKSIKSGDAAIVRMVPQKPMCVEVFNDYA 407
gi 154335074 328 FTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFADIESKIDRRSGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYP 407
gi 146083153 328 FTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYA 407
gi 146083157 328 FTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYA 407
gi 157867418 328 FTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKMVPQKPMCVEVFNDYA 407
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|..
gi 71408910  408 PLGRFAVRDMRQTVAVGIIKAVTKKEGGAGKVTKAAAKASKK 449
gi 71403912  401 PLGRFAVRDMRQTVAVGIIKAVTKKEGGAGKVTKAAAKASKK 442
gi 71403914  408 PLGRFAVRDMRQTVAVGIIKAVTKKEGGAGKVTKAAAKASKK 449
gi 71664927  408 PLGRFAVRDMRQTVAVGIIKAVTKKEGGAGKVTKAAAKASKK 449
gi 71664929  408 PLGRFAVRDMRQTVAVGIIKAVTKKEGGAGKVTKAAAKASKK 449
gi 71746820  408 PLGRFAVRDMRQTVAVGIIKAVTKKDGSGGKVTKAAVKASKK 449
gi 154335074 408 PLGRFAVRDMRQTVAVGIIKAVSKKDGSAGKVTKAAAKAAKK 449
gi 146083153 408 PLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKAAKK 449
gi 146083157 408 PLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKAAKK 449
gi 157867418 408 PLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKASKK 449
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap