Conserved Protein Domain Family
PTZ00299

?
PTZ00299: PTZ00299 
homoserine kinase; Provisional
Statistics
?
PSSM-Id: 140320
View PSSM: PTZ00299
Aligned: 6 rows
Threshold Bit Score: 593.405
Threshold Setting Gi: 72390531
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71399862    1 MSDPPKKVVLRVPATTANLGPAYDVLGMALSIFMEVTVEHADEFSVHLEGDGSEHISADRENLMVKACELAFTEFAKKEM 80 
71656330    1 MSDPPKKVVLRVPATTANLGPAYDVLGMALSIFMEVTVEHADEFSVHLEGDGSEHISADRENLMVKACELAFTEFAKKAM 80 
72390531    1 MCVLPRKVVVRVPATTANMGPAYDSIGMALSIFAELTVEHSDAFSMSVEGEGCEEIQRDEQNMVVRACCLAF-EYGNKKM 79 
146094094   6 ATPLPKKVSLRVPATTANIGPAYDTLGMALSIFMELTVELAETFSMTVTGEGQEYISTGEDNMVVQTCRIAFEEYAHKSM 85 
154341961   6 ATPLPRKVAVRVPATTANIGPAYDTFGMALSIFMELTVELAETFSMTVTGEGHEHISTGEDNMVVQTCRIAFEEYAHKSM 85 
157872776   6 AKPLPEKVSLRVPATTANIGPAYDTLGMALSIFMELTVELAEAFSMTVTGEGQEHISTGEDNMVVQTCRIAFEEYAHKSM 85 
71399862   81 PPLKFIMKSNIPFGCGCGSSSAAAVAGFVAGMKLCGLTMKTEEEEALLQVIARFEGHPDNAAPAIYGGIQLGYKDNNGRF 160
71656330   81 PPLKFTMKSNIPFGCGCGSSSAAAVAGFVAGMKLCGLTMKTEEEEALLQVIARFEGHPDNAAPAIYGGIQLGYKDNNGRF 160
72390531   80 PTLRFIMRSDIPYGCGCGSSSAAAVAGFVAGLQLCGHTMATGSEEELLQAIAKFEGHPDNAAPALYGGIQLCYKEHGGRV 159
146094094  86 PPLKFTMHNNIPYKCGCGSSSAAAVAGFVAGMTLSGLTMETHNNESLLSAISKIEGHSDNAASAIYGGIQLVYKKDDDRA 165
154341961  86 PPLKFIMHNNVPYRCGCGSSSAAAVAGFVAGMTLCGLTMETQNREALLLAISKIEGHSDNAAPAIYGGIQLVYKKDEESL 165
157872776  86 PPLKFTMHNNIPYKCGCGSSSAAAVAGFVAGMMLSGLTLETHNSESLLSAISKIEGHSDNAAPAIYGGIQLVYKKDDGRT 165
71399862  161 LTYRVPTPASLLVVLFVPKNKMKLNTHATRNLIPSSVSLEDTVFNISRSSILVLALCTGDLRLLKSCDDKLHQKQRADAL 240
71656330  161 LTYRVPTPASLLVVLFVPKNKMKLNTHATRNLIPSSVSLEDTVFNISRSSILVLALCTGDLRLLKSCDDKLHQKQRADAL 240
72390531  160 LTTRVPTPFALSVVLFIPREKMKENTHVTRGLIPDFVPLEDAVYNISCASILVLALSTGDLRTLRSCGDKIHEGQRGDAL 239
146094094 166 MTYHVPTPPNLSIVLFVPHKLMKASTHVTRDLVPTTVSLRDAVRNISGTAILTLALSTGDLRMLTDASDCLHEQQRSRKL 245
154341961 166 MTYHVPTPPNLAIVLFVPHRLMKASTHVTRDLVPTTVSLRDAVHNISSTAILTLALSTGDLRMLKDASDCLHEQQRSSKL 245
157872776 166 MTYHVPTPPNLSIVLFVPHKLMKASTHVTRELVPTAVSLRDAVHNISGTAILTLALSTGDLRMLKDASDCLHEQQRSRKL 245
71399862  241 FPHFRPCVDAAMAAGAHYAFLSGAGPSVCALVGGRHGDPLTQPRGERIAESVAEAMIQAANAVGVAGRAILTQPSDQGVH 320
71656330  241 FPHFRPCVDAAMAAGAHYAFLSGAGPSVCALVGGRHGDPLTQPRGERIAESVAEAMIQAANAVGVAGRAILTQPSDQGVH 320
72390531  240 FPHFRPCVNAAKEAGAAYAFLSGAGPTVCALVGGRHGEVLTQPKEERVAERVALAMIDAACAVGVEGRVVITQPSDQGVH 319
146094094 246 YPHYSACAKAAREAGAVYAFLSGAGPSVCAMVPGRHGDLLTQPMEERKAEVVAEAMVKAAEAVGVQGRVIITMPSDFGVH 325
154341961 246 YPHYNACAKAAREAGAVYSFLSGAGPSVCAMVPGRHGDFLSQPEGERKAEMVAEAMVKAAEAVGVHGRAIITIPSNLGAH 325
157872776 246 YPHYSACAKAAREAGAEYAFLSGAGPSVCAMVSGRHGDLLTQPMEERKAEMVAEAMVKAAEAVGVQGRVIITMPSDVGVH 325
71399862  321 CVGVTTIRPDMEYISI 336
71656330  321 CVGVTTIRPDMEYISI 336
72390531  320 VVGAKPVRHNLVYVST 335
146094094 326 LSGTTCIRPNIQYTSI 341
154341961 326 LPGTTCIRPNIQYTSI 341
157872776 326 LSGTTCIRPNIQYTSI 341
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap