Conserved Protein Domain Family
PTZ00298

?
PTZ00298: PTZ00298 
mevalonate kinase; Provisional
Statistics
?
PSSM-Id: 240351
View PSSM: PTZ00298
Aligned: 6 rows
Threshold Bit Score: 604.924
Threshold Setting Gi: 72388266
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72388266    1 MHVAVKDKTTRHHIGYGKVILFGEHFVVYGAESIVAGINEYTTCEISRLKHKPNVVeVIDERPAVPGYIKEKREEQRVAH 80 
71397724   37 MRRAAVERTEKNHIGFGKIILFGEHFVVYGAEALVAGIDEYTSCRLELTKGQPGIC-VVDGRPAVPGYIVEKAEEQRLAH 115
71651924    1 MRRAVVERTEKNHIGFGKIILFGEHFVVHGAEALVAGIDEYTSCRLELTKGQPGIC-VVDGRPAVPGYIVEKAEEQRLAH 79 
154342246   1 MPKPVKSKTTGKHIGYGKVILFGEHFVVYGAEAIVAGIREYTECRLEVTPGVPGLQ-VNDQRPAIPDYITQKRGEQKKAH 79 
146094774   1 MPKPVKRKTTGKNIGYGKVILFGEHFVVHGAEAIVAGISEYTECRLEINPGVPGLQ-VDDQRPAIPGYIAQKRDEQIKAH 79 
157873048   1 MSKPVKSKTTGKNIGYGKVILFGEHFVVHGAEAIVAGISEYTECRLEINPGVPGLQ-VDDQRPAIPGYIAQKRDEQIKAH 79 
72388266   81 GLVLRHLNIDTSKDGLLVKLGGPLVPSSGIGASASDVVSLSRALNELYSLNLSEEAVNRSAYAGECGYHGTPSGVDNTAA 160
71397724  116 RLVFRHLNIDTSVDGVRIHLGGPLVPTSGIGASASDVVSLSRALSEMYGLDLTEDEVNLSAFVGEGGYHGTPSGADNTAA 195
71651924   80 RLVFRHLNIDTSVDGVRIHLGGPLVPTSGIGASASDVVSLSRALSEMYGLDLTEDEVNLSAFVGEGGYHGTPSGADNTAA 159
154342246  80 QLVLDHLQVDLSRDGLKMFIGGPLVPSSGIGASASDVVAFSRALSELYQLNLTEEQVNQSAFVGEGGYHGTPSGVDNTAA 159
146094774  80 QLVLDHLKVDLSRDGLKMLIGGPLVPSSGIGASASDVVAFSRALSELYQLNLTDEEVNQSAFVGEGGYHGTPSGADNTAA 159
157873048  80 QLVLDHLKVDLSGDGLKMFIGGPLVPSSGIGASASDVVAFSRALSELYQLNLTDEEVNLSAFVGEGGYHGTPSGADNTAA 159
72388266  161 TYGGIILFRRALKKSVFSRLALGKTLSIIVCSTGITASTTKVVADVARLKAAQPSWFDDLFEQYNACVREAKKALQSGNL 240
71397724  196 TFGGLISYRRVNGVSNFCRVLITRPLFLVVCSTGITTSTTKVVGEIRELKENNPTWFNALLERYNACVGEAKAAMEVGNV 275
71651924  160 TFGGLISYRRVNGVSNFSRVLITRPLFLVVCSTGITTSTTKVVGEIRELKENNPTWFNALLERYNACVGEAKAAMEVGNL 239
154342246 160 TFGGLISYRRHSGKSIMKSIAFQQCLYLVVVGTGITASTTAVVSDVRKMKERQPEQFQRLCDNYTHIVSQAREALQKGDL 239
146094774 160 TYGGLISYRRHNGKSAFKPIAFQQRLYLVVVGTGINASTAKVVNDVHKMKKQQPAQFKRLYDNYTHIVSQAREALQKGDL 239
157873048 160 TYGGLILYRRQNGKSVFKPIAFQQRLYLVVVGTGINASTAKVVNDVHKMKQQQPVQFKRLYDNYTHIVSQAREALQKGDL 239
72388266  241 RRVGELMNINHTLCQKLTVSCPELDAIATCCRTFGALGAKMSGTGRGGLVVALAANTQERDRIAKAVREQCKEAKFVWRY 320
71397724  276 FRVGELMNENHKLCQELTVSCAELDTIVNFCCENGALGAKMSGTGRGGLVVALAADEAQRDGIADAVRQRCPAAKFVWKY 355
71651924  240 FRMGELMNENHKLCQELTVSCAELDTIVNFCCENGALGAKMSGTGRGGLVVALAADEAQRDGIADAVRQRCPAAKFVWKY 319
154342246 240 LRVGQLMNANHDLCRKIGVSCRELESIVQTCRAYGALGAKLSGTGRGGIAVALAASRDQRDAIVKGLKAECPEAKFIWKY 319
146094774 240 QRLGQLMNANHDLCRQIDVSCRELESIVQTCRTYGALGAKLSGTGRGGIAVALAASSDQRDAIVKGLKAKCPEAKFIWRY 319
157873048 240 QRLGQLMNANHDLCRQIDVSCRELESIVQTCRTYGALGAKLSGTGRGGIAVALAASSDQRDAIVKGLKAKCPEAKFIWRY 319
72388266  321 SVQPGGS 327
71397724  356 TACPRSA 362
71651924  320 TVCPRSA 326
154342246 320 VVQPSAT 326
146094774 320 TVQPSTA 326
157873048 320 TVQPSAA 326
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap