Conserved Protein Domain Family
PTZ00290

?
PTZ00290: PTZ00290 
galactokinase; Provisional
Statistics
?
PSSM-Id: 240347
View PSSM: PTZ00290
Aligned: 7 rows
Threshold Bit Score: 863.747
Threshold Setting Gi: 71425609
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72548353    3 AESYPDERLDSMLATLTPIFCEKFKVENAADVEWRVFTFAPGRVNLIGEHVDYMEGWTCPAAVLEGTHILVGRVKHFQKE 82 
71421788    1 MPSYSDKRIHATVSELKLNFLRTFNVVAEDDVEWLLFTFAPGRVNFFGEHVDYMGGYVCPAALKEGCHILVGRVRHLCDG 80 
71650513    3 PLSYTDGRLDKTLSQLKPLFMKAFSAHDDSDVEWILFAFAPGRVNFIGEHVDYMGGYVCPAAVGDGCHILVGRVKHITDH 82 
71424994    3 PLSYTDERLDKTLRQLKPLFMKAFSAHDDSDVEWILFAFAPGRVNFIGEHVDYMGGYVCPAAVGDGCHILVGRVKHITDH 82 
71425609    1 MPSYSDKRIHATVSELKLKFLRTFNVVAEDDVEWLLFTFAPGRVNFFGEHVDYMGGYVCPAALKEGCHILVGRVRHLCDG 80 
146101227   3 AESYPDERLDSTLATLTTIFCEEFKVENDADVEWLVFTFSPGRVNLIGEHVDYMEGWTCPAAVLEGTHILVGRVKHFQKE 82 
154344859   3 AESYSDERLDSTLQTLAPIFREEFKVENDADVEWLLFTFSPGRVNLIGEHVDYMEGWTCPAAVLEGTHILVGRVKHFEKH 82 
72548353   83 akpKVRFyATHTKEHFDMDHLGGCVHNKAWTTFVRGAMTLRLNRLGVAIDDASLNGVCMVVHSTLAMGAGMSASAAFGVA 162
71421788   81 ---KLRF-AREDDECFVLDRLGQAKHDKNWRTFVRGAATLALNDLGMPIDAPELQGFCAISKGTLPMGSGMSASASFDVA 156
71650513   83 ---KLRF-STTRDEYFELGHLGEKDHNKAWTTFIRGATSIRLSHHGVKLGAEPLKGICMMILGTLEMGAGMSASASFGIA 158
71424994   83 ---KLRF-STTRDEYFELGHLGEKDHNKAWTTFIRGATSIRLSHHGVKLGAEPLKGICMMILGTLEMGAGMSASASFGIA 158
71425609   81 ---KLRF-ATEDDECFVLDRLGQAKHDKNWRTFVRGAATLALNDLGMPIDAPELQGFCAISKGTLPMGSGMSASASFDVA 156
146101227  83 akpKVRFyATYTKEHFDMDHLGGCVHNKAWTTFVRGAMTLRLNRLGVAIDDASLSGVCMVVHATLPMGAGMSASAAFGVA 162
154344859  83 pkpKLRFyATYTKEHFNMDRLGGGKHNKAWTTFVRGAVTLRLNRLGVAINDPSLSGVCMVVHGTLAMGAGMSASAAFGVA 162
72548353  163 LIHAINSVVTKSYKDCPTSSGRRYSIVPAMPKDELMELAKEARLIETEYCGVNVGIMDQFISAFAEVDKFMFLDCKHLTF 242
71421788  157 LLNAITTVATRRYRGKCYVPGTRFPILPPCSREERIKLTKQAHRIETEFCGVNVGIMDQFSAIHATEGSFMALDCDSLTF 236
71650513  159 LLNALSTTITGRYKNPQLTPGRRYAILPRESHDEMIELVKQGRRIETEFCGVQVGIMDQFASAFSVSNKFMVLDCTALTH 238
71424994  159 LLNALSTTITGRYKNPQLTPGRRYAILPRESHDEMIDLVKQGRRIETEFCGVQVGIMDQFASAFSVSNKFMVLDCTALTH 238
71425609  157 LLNAITTVATRRYRGKCYVPGTRFPILPPCSREERIKLTKQAHRIETEFCGVNVGIMDQFSAIHATEGSFMALDCDSLTF 236
146101227 163 LIHAINSVVTRSYKDCPTSSGRRYSIVPAMPKEELMELAKEARLIETEYCGVNVGIMDQFISAFAEVDKFMFLDCKHLTF 242
154344859 163 LIHAINSVVTKNYQGCPTSNGRRYSILPTMPKQELVELAKEARLIETEYCGVNVGIMDQFISALAEADKFMFLDCKDLTF 242
72548353  243 EPVDMTPLLGHGEySWMLIDSMIKHDLLGGTAQMYNSVRIDQENAQKKIGEHRYRGKPYSFSLMVRNPEQYGfdGDVQQF 322
71421788  237 ESHPLSYLLGDSA-CFLLINSMIRHELTGSTAGGYNTLRSDAEGAQAVVRKHKMNNAAFTFRDLARNPKKFT--KDPVAF 313
71650513  239 KLCDITPVTGDDA-CFLLIDSMIKHDLLGATSGTYNTVRSDQEQAQEKISKQILGGKPFTFTELVRDPHKYTttGDAVHF 317
71424994  239 KLCDITPVTGDDA-CFLLIDSMIKHDLLGATSGTYNTVRSDQEQAQEKISKQILGGKPFTFTELVRDPHKYTttGDAVHF 317
71425609  237 ESHPLSYLLGDSA-CFLLINSMIRHELTGSTAGGYNTLRSDAEGAQAVVKKHKMNNAAFTFRDLARNPKKFTk-EDPVAF 314
146101227 243 EPIDMTPLLGHGEySWMLIDSMIKHDLLGGTAQMYNSVRIDQESSQKKIGEHRYRGRPYSFSLMVRNPEQYGfdGDVQKF 322
154344859 243 ETIDMTPLLGDGEySWMLIDSMVKHDLLGGTAQMYNAVRNDLENSQKKIGEHRYRGKPYSFSMMVRNPDQYGfdGDVEKF 322
72548353  323 MAEFKPLMTPGEFERGTYQVMEQLRTLEFRKLNDPALPLSREERVKKAGDILNAGHAGMRELMKITTPELDYIQELINED 402
71421788  314 VESCRPHFTPGQYDRGIFNIAEQIRTLQFIELCRPECLLSQEERFRKAGELLNATHQGQRDLLKISTEELNFIHRAINLE 393
71650513  318 IKSCQKQLTRGEFERGYYNVTEQIRTRDFIALTDASTGLTHEERFREAGRILNEAHEGMKTLMKITTAELDFIHETINQV 397
71424994  318 IKSCQKQLTRGEFERGYYNVTEQIRTRDFIALTDASTGLTHEERFREAGRILNEAHEGMRTLMKITTAELDFIHETINQE 397
71425609  315 VESCRPHFTPGQYDRGIFNIAEQIRTLQFIELCRPECPLSQEERFRKAGELLNATHQGQRDLLKISTEELNFIHRAINLE 394
146101227 323 MAEFKSLMTPGEFERGTYQIMEQLRTLEFRKLNDPTLPLSREERVKKAGEILNAGHVGMRELMKITTPELDYIQELINED 402
154344859 323 MSEFKPLMTPGEFERGTYQIMEQLRTLEFRKVNDATLSLSREERVKKAGAILNAGHAGMRDLLKVTTPELDYLQELINED 402
72548353  403 KDVAGGRMMGGGFGGCIIMLLRRSAEDRVLAHVRKHFKARFSIENSCYKVKrAGSGSFVVSLegkkMSGAGSKL 476
71421788  394 EGVSGGRLMGGGFGGCILLLLKKNALERVVKNVQQKFNSRFGLVCDVYPVV-LGDGAFVASL----WQGVEGKL 462
71650513  398 PGVAGGRMMGGGFGGCIILLLKKNVVDSVVCRVREKFKARFGVENKVYPVV-MGDGAFVVSLa--nKTGPDSNL 468
71424994  398 PGVAGGRMMGGGFGGCIILLLKKNVVDSVVCRVREKFKARFGVENKVYPVV-MGDGAFVVSLa--nKSGPDSNL 468
71425609  395 EGVSGGRLMGGGFGGCILLLLKKNAVESVVKNVQEKFKSRFGLVCDVYPVV-LGDGAFVASL----WQGVKGKL 463
146101227 403 KDVAGGRMMGGGFGGCIIMLLRRSAEDRVLAHVRKHFKARFNMENSCYKVKrAGSGGFVVSLegkkMSGAGSKL 476
154344859 403 KDVAGGRMMGGGFGGCIILLLRSGTEDRVLAHVREKFKARFNVENTCYRMKrAGSGGFVVSLegknQNAAGSKL 476
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap