Conserved Protein Domain Family
PTZ00265

?
PTZ00265: PTZ00265 
multidrug resistance protein (mdr1); Provisional
Statistics
?
PSSM-Id: 240339
View PSSM: PTZ00265
Aligned: 3 rows
Threshold Bit Score: 2635.87
Threshold Setting Gi: 124506379
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386    1 MKKDQRQPRDnsnssNNLSIKDEVEKELNKKGTFELYKKIKTQKIPFFLPFKCLPSSHRKLLGVSFVCATISGGTLPFFV 80
gi 124506379    1 MGKEQKEKKD-----GNLSIKEEVEKELNKKSTAELFRKIKNEKISFFLPFKCLPAQHRKLLFISFVCAVLSGGTLPFFI 75
gi 221056887    1 MKKDQRQSIDnnsggSNLSIKDEVEKELNKKGTFELYKKIKTQRIPFFLPFKCLPPSHKKLLGVSFVCATISGGSLPFFV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386   81 SVFGVIMKNMNLGENVNDIIFSLVLIGIFQFILSFISSFCMDVVTTKILKTLKIEFLKSVFYQDGQFHDNNPGSKLTSDL 160
gi 124506379   76 SVFGVILKNMNLGDDINPIILSLVSIGLVQFILSMISSYCMDVITSKILKTLKLEYLRSVFYQDGQFHDNNPGSKLRSDL 155
gi 221056887   81 SVFGVIMKNMNLGENVDDIIFSLVLIGIFQFVMSFISSFCMDIVTTKILKTLKVEFLKSVFYQDGQFHDNNPGSKLTSDL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386  161 DFYLEQVNAGIGTKFITIFTYASAFLGLYIWSLFKNARLTLCITCVFPLIYICGVICNKKVKINKKTSLLYNNNTMSIIE 240
gi 124506379  156 DFYLEQVSSGIGTKFITIFTYASSFLGLYIWSLIKNARLTLCITCVFPLIYVCGVICNKKVKLNKKTSLLYNNNTMSIIE 235
gi 221056887  161 DFYLEQVNAGIGTKFLTIFTYTSAFLGLYFWSLFKNARLTLCVTCVFPLIYICGVICNKKAKINKKTSLLYNNNTMSIIE 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386  241 EALVGIRTVVSYCGENTILKKFNLSEKLYSKYTLKANLMESLHIGMINGFILASYAFGFWYGTRIIISDLSNQQPNNDFH 320
gi 124506379  236 EALMGIRTVASYCGEKTILNKFNLSETFYSKYILKANFVEALHIGLINGLILVSYAFGFWYGTRIIINSATNQYPNNDFN 315
gi 221056887  241 EALVGIRTVVSYCGEHTILKKFNLSEKLYSKYMLKANFMESLHIGMINGFILASYAFGFWYGTRIIISDLSNAQSNNDFH 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386  321 GGSVISILLGVLISMFMLTIILPNITEYMKSLEATNNLYEIINRKPLVENNQDGKKLKDIKKIQFKNVRFHYDTRKDVEI 400
gi 124506379  316 GASVISILLGVLISMFMLTIILPNITEYMKALEATNSLYEIINRKPLVENNDDGETLPNIKKIEFKNVRFHYDTRKDVEI 395
gi 221056887  321 GGSVISILLGVLISMFMLTIVLPNITEYMKSLEATNSLYEIINRKPLVENNNDGKKLKDIKKIQFKNVRFHYDTRKDVEI 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386  401 YKDLNFTLTEGKTYAFVGESGCGKSTILKLIERLYDPTEGDVIINDSHNLKDVNLKWWRSKIGVVSQDPLLFSNSIKNNI 480
gi 124506379  396 YKDLSFTLKEGKTYAFVGESGCGKSTILKLIERLYDPTEGDIIVNDSHNLKDINLKWWRSKIGVVSQDPLLFSNSIKNNI 475
gi 221056887  401 YKDLNFTLTEGKTYAFVGESGCGKSTILKLIERLYDPTEGDIIINDSHNLKDINLKWWRSKIGVVSQDPLLFSNSIKNNI 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386  481 KYSLYSLKDLEALSEESNEDGFSSQSDSNsrnscrakcagdLNDMIQTTDSTELIQVRKNYETIEDSEVVSVSKKVLIHD 560
gi 124506379  476 KYSLYSLKDLEAMENYYEENTNDTYENKN------------FSLISNSMTSNELLEMKKEYQTIKDSDVVDVSKKVLIHD 543
gi 221056887  481 KYSLYSLKDLEYLSDQLNEDGSASQDGLDkrnscrakcagdLNDMMKTTDSDGLIHARKNYNIIDDSEVVNVSKKVLIHD 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386  561 FVSALPDKYETLVGSNASKLSGGQKQRISIARAIIRNPKILILDEATSSLDNKSEYLVQKTINNLKGNENRITIIIAHRL 640
gi 124506379  544 FVSSLPDKYDTLVGSNASKLSGGQKQRISIARAIMRNPKILILDEATSSLDNKSEYLVQKTINNLKGNENRITIIIAHRL 623
gi 221056887  561 FVSALPDKYETLVGSNASKLSGGQKQRISIARAIIRNPKILILDEATSSLDNKSEYLVQKTINNLKGNENRITIIIAHRL 640
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386  641 STIRYANTIFVLSNRENGstvdvdvlg--edptkdsnEKNEKHDKQEKGGKNSSANQKIGNAGSYIIEQGTHDALMKNKN 718
gi 124506379  624 STIRYANTIFVLSNRERS-------------------DNNNNNNNDDNNNNNNNNNNKINNEGSYIIEQGTHDSLMKNKN 684
gi 221056887  641 STIRYANTIFVLSNREKGnrstvdvdiigedptkdnkENKQKNGKKG----DTNKNEKMSNAGSYIIEQGTHDALMKNKN 716
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386  719 GIYYTMINNQKVSSKSSSNNDNDKDSDMKSSIYKDSERGYDPDEANGNAK--NESASAKKSEKmsdaKASNTNAGGRLAF 796
gi 124506379  685 GIYHLMINNQKISSNKSSNNGNDNGSDNKSSAYKDSDTGNDADNMNSLSIheNENISNNRNCK----NTAENEKEEKVPF 760
gi 221056887  717 GIYYTMINNQKVSSKTSNNNDNDKDSDMKSSVYKDSERGYDPDEMNGNTKngNESASDKKSNKmsdeNASSKNAGGKLSF 796
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386  797 LRNLFKRKPKAPNNLRVVYREIFSYKKDIAIIALSIMVAGGLYPLFALLYAKYVGTLFDFANLEANSNKYSLYILVIAIA 876
gi 124506379  761 FKRMFRRKKKAPNNLRIIYKEIFSYKKDVTIIFFSILVAGGLYPVFALLYARYVSTLFDFANLEYNSNKYSIYILLIAIA 840
gi 221056887  797 LRNLFKRKPKAPNNLRMVYREIFSYKKDVVIIALSIIVAGGLYPMFALLYAKYVSTLFDFANLEANSNKYSLYILVIAIA 876
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386  877 MFISETLKNYYNNVIGEKVEKTMKLRLFENIMYQEISFFDQDSHAPGLLSAHINRDVHLLKTGLVNNIVIFTHFIVLFLV 956
gi 124506379  841 MFISETLKNYYNNKIGEKVEKTMKRRLFENILYQEMSFFDQDKNTPGVLSAHINRDVHLLKTGLVNNIVIFSHFIMLFLV 920
gi 221056887  877 MFISETLKNYYNNVIGEKVEKTMKHRLFENILYQEISFFDQDCHAPGLLSSHINRDVHLLKTGLVNNIVIFTHFIVLFIV 956
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386  957 STVMSFYFCPIVAAVLTGTYFIFMRVFAIRARIAANKDVEKKRvNQPGTAFVYNSDDEIFKDPSFLIQEAFYNMNTVIIY 1036
gi 124506379  921 SMVMSFYFCPIVAAVLTFIYFINMRVFAVRARLTKSKEIEKKE-NMSSGVFAFSSDDEMFKDPSFLIQEAFYNMHTVINY 999
gi 221056887  957 SMIMSFYFCPIVAAVLTGTYFIFMRVFAIRARLSANKDVEKKGiNQPGTVFLYNNDDEIFKDPSFLIQEAFYNMNTVIIY 1036
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386 1037 GLEDYFCTLIEKAIDYSNKGQKRKTLINSMLWGFSQSAQFFINSFAYWFGSFLIRRGTIQVDDFMKSLFTFLFTGSYAGK 1116
gi 124506379 1000 GLEDYFCNLIEKAIDYKNKGQKRRIIVNAALWGFSQSAQLFINSFAYWFGSFLIKRGTILVDDFMKSLFTFIFTGSYAGK 1079
gi 221056887 1037 GLEDYFCKLIEKAIDYSNKGQKRKTLVNSMLWGFSQSAQLFINSFAYWFGSFLIRRGTIEVDDFMKSLFTFLFTGSYAGK 1116
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386 1117 LMSLKGDSENAKLSFERYYPLITRKSLIDVRDNGGIKIkNSNDIKGKIEIMDVNFRYLSRPNVPIYKDLTFSCESKKTTA 1196
gi 124506379 1080 LMSLKGDSENAKLSFEKYYPLMIRKSNIDVRDDGGIRI-NKNLIKGKVDIKDVNFRYISRPNVPIYKNLSFTCDSKKTTA 1158
gi 221056887 1117 LMSLKGDSENAKLSFEKYYPLIMRKSNIDVRDNGGIRIkNTNDIDGKIEIMDVNFTYMSRPNVPIYKDLTFSCDSKKTTA 1196
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386 1197 IVGETGSGKSTVMSLLMRFYDLKNDHHIVfkneqTGESSKEQMQQGDEEQNVGMKNANEFSssKEGADGQSSTLFKNSGK 1276
gi 124506379 1159 IVGETGSGKSTFMNLLLRFYDLKNDHIIL-----KNDMTNFQDYQNNNNNSLVLKNVNEFS--NQSGSAEDYTVFNNNGE 1231
gi 221056887 1197 IVGETGSGKSTVMSLLMRFYDLKNDHHIVfknehTDDVNNEKKEQGDEEQNVGMKNVNEFSltKEGSHGDNSAVFKNSGK 1276
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386 1277 ILLDGVDICDYNLKDLRNLFSIVSQEPMLFNMSIYENIKFGKENATREDVKRACKFAAIDEFIESLPNQYDTNVGPYGKS 1356
gi 124506379 1232 ILLDDINICDYNLRDLRNLFSIVSQEPMLFNMSIYENIKFGREDATLEDVKRVSKFAAIDEFIESLPNKYDTNVGPYGKS 1311
gi 221056887 1277 ILLDGVDICDYNLKDLRNLFSIVSQEPILFNMSIYENIKFGKEDATREDVKRACKFAAIDEFIESLPNKYDTNVGPYGKS 1356
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156095386 1357 LSGGQKQRIAIARALLREPKILLLDEATSSLDSNSEKLIEKTIVDIKDKADKTIITIAHRIASIKRSDKIVVFNNPDRTG 1436
gi 124506379 1312 LSGGQKQRIAIARALLREPKILLLDEATSSLDSNSEKLIEKTIVDIKDKADKTIITIAHRIASIKRSDKIVVFNNPDRNG 1391
gi 221056887 1357 LSGGQKQRVAIARALLREPKILLLDEATSSLDSNSEKLIEKTIVDIKDKADRTIITIAHRIASIKRSDKIVVFNNPDRTG 1436
                        1450      1460
                  ....*....|....*....|....*...
gi 156095386 1437 SFVQAQGTHEELLSVQDGVYKKYVKLAK 1464
gi 124506379 1392 TFVQSHGTHDELLSAQDGIYKKYVKLAK 1419
gi 221056887 1437 SFVQAEGTHEELLSVQDGVYKKYVKLAK 1464
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap