Conserved Protein Domain Family
PTZ00050

?
PTZ00050: PTZ00050 
3-oxoacyl-acyl carrier protein synthase; Provisional
Statistics
?
PSSM-Id: 240245
View PSSM: PTZ00050
Aligned: 15 rows
Threshold Bit Score: 567.014
Threshold Setting Gi: 167535336
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146098130   1 MVTPLGVTAV-DTWAAVCRGQSGCRPLIEAPyflpgflendkmlspqqkaaaleklVAALPCKVAAFVQPPAEVGLAagk 79 
156101157  67 VVNGVGVGLE-KFWENLISGYNSIDKITKFD-------------------------VTGMACGIGSEIDKKNFTPSD--- 117
71649628   23 AVTPLGLDVA-STWAALCQGRSATRPLKEVPfffpacidsdrrltpaarqksheqlLAKMPCQVAAPVLAPSGRPN---- 97 
66820316  127 IVSPLGVGIK-YNWDKLINGESGIKRFEGFEdsridcpskvvarvpkgegigefnsNTMIPSQVK--------------- 190
84043634   21 AVTPLGVGAQ-STWSALCEGKSATRALREAPfffpssidsdrrltteekgkrreelLAAMPCQVAAPVIGELVSTTDlp- 98 
118367131  14 AVSPIGLNAS-SSWESLIAGKSGIISTSEYVkkiqqndptnkl--anpdywpldtyVAAVPDGFDNLKKWKVAFST---- 86 
145542945  11 MVSPLGLNVS-ESWNSLLAGKSGVVRVKDRNkdlp------------------dvyMGLIPQSFDTKPYQVEYCP----- 66 
167535336  12 LITPLGCGPHpRLYEHLLHKASGVRQLRDREay----------------------eQAKVPVHIAAEVPALDQDSELg-- 67 
237841727 137 VVSGVGIGID-EFWKNLIAGTNVIDKVTRFD-------------------------PSNMTCQIACEVSNEKFDPKA--- 187
221057808  67 VVNGVGIGLE-KFWENLISGYSSIDKITKFD-------------------------VTGMNCGIGSEIDKKNFNPSD--- 117
146098130  80 vdkavpaadpFAPTAHE--------PRALRLCARAVEEALADAALQ---------------------------------- 117
156101157 118 ----------YYTNKKDan----rnDDCTHYAVAATRLAIDDAKID---------------------------------- 149
71649628   98 ----------FTPTLRE--------TRATLFAYYAAEEALTHARLLefpa---------------------------kri 132
66820316  191 ----------LAS------------SDFIKYAIVATDEAIKDSKLDkf------------------------------ie 218
84043634   99 ---------nFAPTSRE--------TRATRFALHAVREALIHAKLIgtdvfcalpsgavahpneaasdnskrssaperri 161
118367131  87 -------------------------NNTNSYAMAAANEAIEDSGIQil------------------------------lq 111
145542945  67 -------------------------SNLTSYAMCAAQEAIADSNVL---------------------------------- 87 
167535336  68 ----------FDPAHYSyplhrralPPNIQFALAAAEQALCDAQLTtrdqp-------------------------dlqa 112
237841727 188 ----------FFTDPKEvk----rnDRYTHFAVAGARLAMEDAGLSp--------------------------------r 221
221057808 118 ----------YYTNKKDan----ryDDYTHYAVAGTRLAVDDAKID---------------------------------- 149
146098130 118 LSEAVQDRCGVNIGMGIPSLADVTDVSAYLTGDaiatd---------aghvHYSKVPPMFLPKILGNMAAGNTAIRHKLR 188
156101157 150 LHKIDCNKVGTIIGSGIGGLLFLEKEMKTLYEK------------------GHKRISPYLIPAMIANTPAGFVSMEHNLR 211
71649628  133 LASFAKERIGVNIGVGMPSLADVGDVSYSLYADpe--------------nvNYNRVNPLFVPKILGNMVTGLTAMKYGIM 198
66820316  219 SNEKLQERIGVCIGSGTGSMEEIISANEKISNKlnnnnnnsdsgsgsgsggGGGKVSAYFIPKILINEASGIISILHKAK 298
84043634  162 ASSCSAERIGVNLGVGMPSLVDVCDAAYNLFADpa--------------qiRYNSISPLFVPKILGNMLTGLVAMTYNVH 227
118367131 112 NNESLQNQAGVNIGVMSSNISKLTEIVRETEKK------------------GFQNLNRLTILQILTNMATANVSLKYQLK 173
145542945  88 -NDCDPDRIGVNIGVMNSSMTKITEIISNAALK------------------GTSRINPFTMLYVLSNMPTALLTIKYKLK 148
167535336 113 HAGLDPTRAGVAVGTGISGVHDLLSNQTLLQER------------------GHRRVSPYLIPNALVNMSAGLVSIHHNLQ 174
237841727 222 APNVDPERFGIVVGSGIGGLETMEQEMKVLQEK------------------GPRRVSPFLIPAMIANTASGILAIELGAK 283
221057808 150 LQKIDPNKVGTIIGSGIGGLLFLEKEMKTFYEK------------------GHKRVSPYLIPAMIANTSAGLVSIEHNLR 211
146098130 189 GPIGSSVAACATGAHCIGEAALWIREGRADVMVCGAAEACITPVSVAGFTRMRALCTRFND--TPSSASRPFDITRAGFV 266
156101157 212 GISLGMLSACATSGNTIGEAYRYIKYKEYDVMVCGGTEASITPISFAGFNALRALCSGYND--NPKKGCRPFDLKRSGFV 289
71649628  199 GPVGSSVAACATGAHCIGEAAEWIRGGRADIVVCGGTEACITPVSIAGFSRMRALCTKYND--MPQEASRPFDKDRGGFV 276
66820316  299 GPNMSIVSACATGSHCIGESFRKIKYGEVDAMICGGTEASINSVSMIGFSRMKALSTKYNNhiNPSSSSRPFDEGRDGFV 378
84043634  228 GPVGSSVGACATGGHCIGESASWIQQGRADVVICGSAEACITPVAIAGFSRMRALCTKYNN--RPQEASRPFDKDRAGFI 305
118367131 174 GPSGTASTACATGASAIGDAFRNIQFGDAKIMIAGGSEDSLSPTNAYASMKLQAMTTKKYD--KPEFASRPFDADRSGFV 251
145542945 149 GPSSTASTACATGASAIGDSFRKIKYGDADIMIAGGTEDTFNTTAIYASIKMQAMSTKIYD--DPTRASRPFDEERSGFL 226
167535336 175 GPNLSASTACATGAHSIGDAFRMIKYDDADIMVCGGAEACIHPLIMSGFARAKALASTFND--TPDRASRPFDQARAGFV 252
237841727 284 GPNHGAVSACATSGHAAGVALRYLQMGEADIVICGGAEASITPLSFAGFNALKAMAQGFND--DPKRASRPFDKKRAGFV 361
221057808 212 GISLGMLSACATSGNTIGEAYRYIKYKEYDVMICGGTEASITPISFAGFNALRALCSGYND--NPKKGCRPFDFKRSGFV 289
146098130 267 MGEGAGVLILEALEHAVARAApRVYAELRGFGISCDAHHVAVPHPEGLGARRCVEQALAEgGDVPAAAVGYVNAHATGT- 345
156101157 290 MGEGAGILILESYEHALRRNA-KIYGEVLAYSSESDAFHITSPEPSGRGLCNSINKAIKN-ANINLSDVKYVNAHGTSTn 367
71649628  277 MGEGSGIIVLEHLEHAMQRGA-QIFAEIRGFGISSDAHDLAAPHPEGRGAQLCLRSALEDgGNISIDDVAYVNAHATGT- 354
66820316  379 MGEGSGILILEEYEHALKRGA-NIYCEITGYGSTGDAHHISAPNSDGNGPLRSMNLALLEsGLPNSSHIDYINAHATSTp 457
84043634  306 MGEGAGVLVLESLEHARERGA-HIIAELRGFGTSSDAHDVAAPRPDGYGAKLCLRSALRDgGDVPAACVAYVNAHATGT- 383
118367131 252 LGEGAGILVLEELQHALSRNA-KIYAELVSYGQSSDGYHLTRPIETGEGGLRAMQNAINH-AQINSNQINLINCHATSTp 329
145542945 227 LAEGSGILVLEEYSRAKRRGA-KIYAEILGYGESSDAFHLTRPQDNGEGGRAAMLKALKEa---NINDVDLINCHATSTk 302
167535336 253 MGEGAAVLILEEEAHARARNA-PIYAQVLGYGASGDAHHITAPHPSGRGAIGCMQAALRE-ARLEGSDVQYVNAHATSTp 330
237841727 362 MGEGAGIMVFETEEHAVRRGApKIYGEVAGYGASCDAHHITAPAPDGSGLSRCLENAIAD-ANIDKRDIGYINAHGTSTp 440
221057808 290 MGEGAGILILESYEHALRRNA-KIYGEILAYSSESDAFHITSPEPNGRGLCNSINKAIKN-ANINISDVKYVNAHGTSTh 367
146098130 346 IGDEVELMAIQQALRPSTap-------ssPALHVSSAKGGLGHLLGAAGSVEAALTVLALHEQRAPPTANLTASCLTREq 418
156101157 368 LNDKIETKVLKTVFKDHA-----------YKLHISSTKSMTGHCIGAAGAIESIVCLKAMQTNIIPPTINYENKDDECD- 435
71649628  355 IGDDMELHALDKVLGGDGtss------hrRPVYVSSVKGGLGHLLGAAGSVEAIVTIMSLYHQQAPPNINLHAPSAEGLe 428
66820316  458 LGDGIECTAVKNFYNNNNnnnnnnnnnnnKEIIMSSNKGSIGHLLGAAGSVESIFSILSLYNNIIPPTLNLENPSKDCQg 537
84043634  384 IGDDLELHAIEAVLNGTDgsdnksaiirnSPLLVSSVKGGIGHLLGAAGSVEAAVAVMALHEQRAPPNVNLHVPSFPASg 463
118367131 330 AGDLAEIVAINKFFDNNLds--------iKNCLVTANKGAIGHTFGAAGAIESIFTILSIKNGISPLIKNLQNPISEPF- 400
145542945 303 GGDIAEARAIAD-----------------SKATLVANKSQLGHTFGAAGAIESIFTIKSLQEQIIPPTINLDKPI----- 360
167535336 331 IGDEIEGRAIAQVCG--------------PSVAVSSTKGATGHLLGAAGALEAAFAILALKHQTAPPTLNLESPAEGLD- 395
237841727 441 MNDRIETKAFKKVFGDEQa----------RQLLISSTKSMTGHCLGATGGIEACVSAKVLETGIVPPTINQEETDPECD- 509
221057808 368 LNDKIETKVLKTVFKDHA-----------YKLHISSTKSMTGHCIGAAGAIESIVCLKTMQTNIIPPTINYENKDAECD- 435
146098130 419 qecgLVCIQGSTAQPMQSCEAVISTSFGFGGINTALLFTRM 459
156101157 436 ----LNYTPNESLHSKESIDISLNTNLGFGGHNTALLFGKI 472
71649628  429 ---rLQLVRGNAPLPFQG-DAVISTSFGFGGVNTALLLTRV 465
66820316  538 ---iNLVQFKSQSKPI---RNVLKNSFGFGGTNCSLIFSKI 572
84043634  464 ---aIQLVQGTTACAFKG-EAVLSTSFGFGGMSTALLFTQF 500
118367131 401 ----VNLSKETVSHDI---KYALKNSFGFGGVNVSLLFKKF 434
145542945 361 ----IRENQYCKEATEKSLKYALKNAFGFGGVNVSLAFGKY 397
167535336 396 ----LNLLTQATQLSL---DVALSNSFGFGGTNVSLAFGKA 429
237841727 510 ----LNYVPNKAYTSPTPFEAVLSDTLGFGGHNAALLLRRY 546
221057808 436 ----LNYTPNKSLHSKENIDISLNTNLGFGGHNTALLFGKI 472
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap