Conserved Protein Domain Family
ruvA

?
PRK13901: ruvA 
Holliday junction DNA helicase RuvA; Provisional
Links
?
Statistics
?
PSSM-Id: 139961
View PSSM: PRK13901
Aligned: 8 rows
Threshold Bit Score: 286.719
Threshold Setting Gi: 203287496
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15594369    1 MINKIHGKVIEKKESSLVLMTTVFEFELLVSAFCLANFNLSDKVELFTYLYTRENELKLFGFLNSDEREIFKELIGVSGV 80
gi 187917906   1 MINKIYGKIIEKRESSIVIVALPFEFEVLVSSFCNAELRLLEDVEILTYLHLREDEIKLFGFLNVSEREVFEELISVDGI 80
gi 51598286    1 MINKIHGKVIEKKESSLVLMTTVFEFELLVSAFCLANFKLSDKVELFTYLYARENELKLFGFLNSDERETFKSLIGVSGI 80
gi 111114845   1 MINKIYGKVIEKKESSLVLMTAVFEFELLVSAFCLANFKLLDKVELFTYLYTKENELKLFGFLNSDERETFKSLIGVSGI 80
gi 119952829   1 MINKICGKIVEKRESSIVIVALPFEFEILVSSFCNAELGLQEDVEILTYLHLREDEIRLFGFLNVSEREVFEKLISVDGI 80
gi 203283953   1 MINKIYGKIVDKKESSIIILAFPFEFEILVSSFCKMELRLLEDVEILTYFHFRDDDVKLFGFLNISEREVFEDLIGVDGI 80
gi 203287496   1 MINKIYGKIVDKKESSIIILAFPFEFEILVSSFCKMELRLLEDVEILTYFHFRDDDVKLFGFLNISEREVFENLIGVDGI 80
gi 218249661   1 MINKIHGKVIEKKESSLVLMTTVFEFELLVSAFCLANFNLSDKVELFTYLYTRENELKLFGFLNSDEREIFKELIGVSGV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15594369   81 GPRAALRVLSNIRYNEFKEAIDKEDIELVSKIKGIGKKMAGKMFLHLQGKLLINSELEStGLFRFKELEESIVSMGFDRK 160
gi 187917906  81 GPRAALRMLSGMKYDEFRDAIEREDVKRISTVKGIGNKVAGKIFLKLRGKLVKADELTS-SVFKFKDLEQSIVNMGFDRK 159
gi 51598286   81 GPRAALRVLSNIRYNDFKEAIDREDVELVSKIKGIGKKMAGKMFLHLQGKLLINNELES-SLFGFKELEESIVSMGFDRK 159
gi 111114845  81 GPRAALRVLSNIRYNEFKDAIDREDIELIAKIKGIGKKMAGKMFLHLQGKLLINNELES-SLFRFKELEESIVSMGFDRK 159
gi 119952829  81 GPKAALRILSGIKYNEFRDAVEREDVKLISNVKGIGNKMAGKIFLKLRGKLVKVNEASS-GVLKFKELEQSIVNMGFDRK 159
gi 203283953  81 GPKAALKILSGIKYDAFRLAIAKEDINLISKVKGIGNKIAGKIFLKLRGKLVKGDESSS-YMLKFKELEQSIVNMGFDRK 159
gi 203287496  81 GPKAALKILSGIKYDAFRLAIAKEDINLISKVKGIGNKIAGKIFLKLRGKLVKGDESSS-YMLKFKELEQSIVNMGFDRK 159
gi 218249661  81 GPRAALRVLSNIRYNEFKEAIDKEDIELVSKIKGIGKKMAGKMFLHLQGKLLINSELEStGLFRFKELEESIVSMGFDRK 160
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 15594369  161 IVNSKIREAFNLAEFANLKDSEKEQFLFKEVLKRISN 197
gi 187917906 160 LVVAAIKEIMLIDEFLMLREVEQEQFLFRETLKRLSG 196
gi 51598286  160 IVNSKLKEACDLIEFSNLKDSEKEQFLFKEVLKRMSN 196
gi 111114845 160 IVNSKLKEAFNLVEFSNLKDSEKEQFLFKEVLKRMSN 196
gi 119952829 160 LVAAAIKEIMLIDEFLMLRQVDQEQFLFREILRKLSG 196
gi 203283953 160 LVVVAFREIMLSDKFLILKEAEQEQFLFTETLKRLSV 196
gi 203287496 160 LVVVAFREIMLSDKFLILKEAEQEQFLFTETLKRLSV 196
gi 218249661 161 IVNSKIREAFNLAEFANLKDSEKEQFLFKEVLKRISN 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap