Conserved Protein Domain Family
PRK13808

?
PRK13808: PRK13808 
adenylate kinase; Provisional
Statistics
?
PSSM-Id: 172341
View PSSM: PRK13808
Aligned: 10 rows
Threshold Bit Score: 352.653
Threshold Setting Gi: 209884834
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
39936292    1 MRLILLGPPGAGKGTQAGRLVEQHGIVQLSTGDMLRAAVAAGTPIGLKAKDIMAAGGLVPDEVVIGIISDRIDQDDAAQG 80 
115525564   1 MRLILLGPPGAGKGTQALRLVERHGIVQLSTGDMLRAAVAAETPVGLKAKDLMASGALVPDEVVIGIISDRLEQDDAANG 80 
148256371   8 MRLILLGPPGSGKGTQAQRLVQQYGIVQLSTGDMLRAAVAAQTPIGLKAKDIMAAGGLVPDEVVVGIIADRIEQPDAANG 87 
146340078   1 MRLILLGPPGSGKGTQAQRLVQQYGIVQLSTGDMLRAAVAAQTPIGLKAKDIMAAGGLVPDEVVVGIIADRIEQPDAANG 80 
86749436    1 MRLILLGPPGAGKGTQAARLVQQYGLVQLSTGDMLRAAVAAGTPVGLKAKDIMASGGLVPDEVVIGIISDRIEQPDATNG 80 
90424916    1 MRLILLGPPGAGKGTQALRLVQRYGIVQLSTGDMLRAAVKAQTPIGLKAKDIMASGALVPDEVVVGIISDRLDQPDAANG 80 
91977631    1 MRLILLGPPGAGKGTQAARLVQQYGIVQLSTGDMLRAAVAAGTPVGLKAKDIMASGGLVPDEVVIGIISDRIEQSDAANG 80 
27380490    1 MRIILLGPPGSGKGTQAQLLVERYGIVQLSTGEMLRAAVAAGTPVGLKAKEIMASGGLVPDDVVVGIISDRIDQPDAKNG 80 
192292016   1 MRLILLGPPGAGKGTQAGRLVEQHGIVQLSTGDMLRAAVAAGTPVGLKAKDIMAAGGLVPDEVVIGIISDRIDQDDAAQG 80 
209884834   1 MRLILLGPPGAGKGTQAQRLVQRHGIVQLSTGDMLRAAVAAETPTGLIAKDIMASGGLVPDEVVVGIIADRIEQDDAKGG 80 
39936292   81 FILDGFPRTVPQAEALDRLLKDKGFDLDAVVELKVNEGALLDRVETRVAEMRARGEEPRADDNAEALAKRLSAYRAQTEP 160
115525564  81 FILDGFPRTVPQAEALDALLKEKGIALDAVVELKVNEGALLARVENRVAEMRARGEEPRPDDNAEALAKRLSSYRASTEP 160
148256371  88 FILDGFPRTVPQAEALDALLKQKQMTLDAVIELKVNEGVLLERVERRAAETRARGEPVRADDTPEVLTKRLASYRDQTEP 167
146340078  81 FILDGFPRTVPQAEALDALLKQKQMNLDAVIELRVNEGVLLERVERRAAETRARGEAVRADDTPEVLTKRLHSYRDQTEP 160
86749436   81 FILDGFPRTVPQAEALDALLKDKKLGLDAVVELRVNESALLARVETRVAEMRERGEEPRADDNAEALAKRLTAYRLQTEP 160
90424916   81 FILDGFPRTVPQAEALDLLLKAKQLKLDAVVELRVNEGALLARVETRVAEMQARGEAVRADDTPEVLSKRLASYRSQTEP 160
91977631   81 FILDGFPRTVPQAEALDRLLKDKRIGLDAVVELRVNESALLARVETRVAEMRERGEEPRADDNAEALSKRLSAYRAQTEP 160
27380490   81 FILDGFPRTVPQAEALDELLRQKHLKLDAVIELRVNESALLSRVETRVAQMRERGEEVRLDDTPEVLTKRLASYRSQTEP 160
192292016  81 FILDGFPRTVPQAEALDRLLKDKGFDLDAVVELKVNEGALLDRVETRVAEMRARGEEPRADDNAEALAKRLSAYRAQTEP 160
209884834  81 FILDGFPRTVAQAEALDELLKKKKLKLDAVVELRVNEGALLARVENRIAEMRARGENVRADDTPEVLAKRLANYREQTEP 160
39936292  161 LVDYYSEKRKLLTVDGMMTIDEVTREIGRVLDAVRAADAKKGAKAkgtkasrakrtvktakkaatkgkaaksaakapkka 240
115525564 161 LVDYYSEKRKLLTVDGMMSIDEVTKEIDRVLSAIGAGETKPARKAs---------------------------------- 206
148256371 168 LIHYYSDHRMLATVDGMMPIEQVTAEIGRILAAVGKGGTSRAAKN----------------------------------- 212
146340078 161 LIHYYSDHRMLATVDGMMPIEEVTEEIGRILAAVGKSAGSRAAKK----------------------------------- 205
86749436  161 LVEYYSDKRKLLTVDGMMTIDEVTREIGRILEALGEANAKKAAKTaaakra--------------------------vkk 214
90424916  161 LIHYYSEQRKLLTVDGMMTIEEVTKEIDRVLAAIRSADAKKTVAK----------------------------------- 205
91977631  161 LVEYYSEKRKLLTVDGMMTIDEVTREIGRILGALGQANDKKAAKTaaakrs--------------------------vkk 214
27380490  161 LIHYYSERRKLSTIDGMMAIDEVTRAVHRQLLALGAVEPKTHGKG----------------------------------- 205
192292016 161 LVDYYSEKRKLLTVDGMMTIDEVTREIGRGLDAVRAADAKKGAKAkgtkasrakrtvktakk----aatkgnaakapkka 236
209884834 161 LVHYYADKRALVTVDGMMPIEEVTGAIERVLSAITEPNEPAQAAT----------------------------------- 205
39936292  241 aakPAAKSGAKSGSAKKSSAKQTVGKKSSGKTAVSKKVAGKPAASKAGKAAvgKTAKAGLKKAAKAVAKAGKK-----AA 315
115525564 207 ---KPRVTKAKVKAAEAKTAKTKVAKTKAAKTKVSKTKAAKPADSAAKPAKkaKKPQKAAKSAKKATKKAAKKavkkvAA 283
148256371 213 -------ASPAKRSAKPPTKAAKTSTKTATKSAAAAKKAGKTAKKAVKTVK--KAAKKAPAKAPKKVARAPAK-----AR 278
146340078 206 -----ASPAKRSAKTAAPPKAAKKAAKRASKTAAPAKKAAKKAAKPA------KTAKKAAKTVKKTVKKAAKK-----SS 269
86749436  215 sakPAKASGKPKASGKAKAPGKAPAKKASAKKAVSGKSSSKAESA--------KTASAGLKKPAKATKKTGKK-----AA 281
90424916  206 ---AAAAKSARRASKAIGTAARKPSRKAADSAAKPAKPATKTVAKPSAKSK--APAKKTTKTTTKSAAKAAAK-----TK 275
91977631  215 svkQPAGKASAKKASKDKSVSDKTSSKKASARKAAKKASTKAPAKAVTAKKaaKKAAAGVKKAAKVTKKTAKK-----PA 289
27380490  206 -----------TAKGTAQSAAKTAPAKKGAAKAKTAKKSAKTAKKPAKSAK--KATKKAVKGTKKAVKKTAKKtvkkaAK 272
192292016 237 takPAAKSGAKSRSAKKSSAKQTVGKKSSGKTAVSKKAAGKPAASKAGKAAvgKTAKAGLKKAAKAVAKAGKK-----AA 311
209884834 206 -----RKTTVKRAATRATKTRSAKSASKAPAKARSAKKAAKSAKKAAKSAKkaGKAAKNGAKKAASARKTAKKaprkvAK 280
39936292  316 KAAVKAAKGAAKPTAGKKAAGKKATKKAAATSKAKAVAKAPARGS---------------KKAKKATKKRA 371
115525564 284 KGARKAAKSPAKAKKSPAKAKKAPGKTKASGAKGKTAAKGKKSVAksdkktvkkarkaagKSGKKVTKKRG 354
148256371 279 KAAAKASKSAAKATKGTR------------------------------------------KTSAKAAKKRA 307
146340078 270 KAAAKATKGTR-------------------------------------------------KTSSKSAKKRS 291
86749436  282 KVASKAPAKAAKTAGKKA-----------NKSKAKSAAKAPKRGAkvtkkaakkagtpsaQKARKVNKKRA 341
90424916  276 KPAAKTKKPSAKANKPAAKAKKPVSKTKTPGAKAAKTAKTASRKAa-------------gKSGKKVTKRRA 333
91977631  290 KAPAKKATGKKVAGKAPAKAKSQAKVDLKAKSNAKAKAETPKGGAkagsksgkkasgavaKKAKKVTKKRA 360
27380490  273 KTARKAVKKGAK------------------------------------------------KAAKKVAKKRA 295
192292016 312 KAAVKAAKGAAKPTAGKKAAGKKATKKAAATSKAKAVVKAPARGS---------------KKAKKATKKRA 367
209884834 281 KTAKKVTKKVSSGGKKAATGASRGGRKAAAGTSRNSTGRAVKARSagtrkavkklvkgrsKTAKRLTKRR- 350
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap