Conserved Protein Domain Family
PRK13768

?
PRK13768: PRK13768 
GTPase; Provisional
Links
?
Statistics
?
PSSM-Id: 237498
View PSSM: PRK13768
Aligned: 52 rows
Threshold Bit Score: 276.365
Threshold Setting Gi: 11498150
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126466209   1 MPIITVFVGPAGSGKTTLVKTYSEWLRRtLFMHVAIVNLDPGVEELPYKPLFDIREWFTLRDIMRKyRLGPNGAFLKASE 80
gi 119873431  17 WVVIVVVFGPAGSGKTTLVGEFGRYLSE-QEFSVAYVNLDCAVESLPYRPNFDVRNYFTLVDIMRRfGLGPNGALVKSME 95
gi 14521637   28 RAMIVVFVGTAGSGKTTLTGEFGRYLED--NYKVAYVNLDTGVKELPYEPSIDVREFVTVEEIMRE-GYGPNGAIVESYD 104
gi 18976856    1 --MIIAFLGTAGSGKTTLTGAFGRYLEE--NYRVAYVNLDTGVENLPYKPDIDVRDFITVRDLMKE-GYGPNGAIVESYD 75
gi 14590504    3 GTMIIVFVGTAGSGKTSLTGAFGEYLEE--NYKVAYVNLDTGVKELPYKPDIDVREFVTVEEIMKE-GYGPNGAIVESYD 79
gi 11498150    1 --MEVFVLGCAGSGKSTFVRSFSEFLQE-RGYSVKCVNLDPASDP-AYRADKNVREFVKTENVMVEyGLGVNGALIKSVE 76
gi 170291001   1 -MKGVIVLGTAGSGKTTFTANFSRWLNGnFLIKSCPVNLDPGASSLPYEPSYDIRDIISVEDLMRReNLGPNGAIVRAAD 79
gi 240103994   1 --MIVAFLGTAGSGKTTMAGSFGRYLEE-QGHSVAYVNLDTGVRKLPYEPDLDVREIVTVEELMAE-GYGPNGAIVESYD 76
gi 284162041   1 --MNIVVVGPAGSGKSTFVKNFSEYLKE---YNVKVVNLDPASDPI-YRADRDIREFVRTEDVMKKfKLGINGALLKSIE 74
gi 288932506   1 --MNVILVGPAGSGKSTFAKEFSTYLRE-GGYDVKVVNLDPATDPI-YEADRNLRDFIKTEEVMKKfKLGINGALIKSME 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126466209  81 MLISKINDLFKHTPFNDItkwDMILIDTPGQMEAFIFRPVSTVFFKILTKISNPVVVFVIDASAIETLSDAVTLWFLGVL 160
gi 119873431  96 LLLDLVGEVSSKLEKLGLl-yDYVFVDTPGQLELTLFHDAVVKLVESFAR--RGLALFLTPADMLKRPRDLVFLNLMALA 172
gi 14521637  105 RLMEKFNEYLNKILRLEKe-nDYVLIDTPGQMETFLFHEFGVRLMENLP---YPLVVYISDPEILKKPNDYCFVRFFALL 180
gi 18976856   76 RLLTRVEHYINKILELEKs-nDYVLIDTPGQMETFIFHEFGVKLMNNLP---YPLVVYLSDPEILKRPHDYCFVRFFSLL 151
gi 14590504   80 RLMNKFDYYLKEILELESk-kDYVLIDTPGQMETFLFHEFGVKLMENLP---YPLVVYLSDPEILRKPTDYCFVRFFALL 155
gi 11498150   77 IASEHAEELKAEG--------DFVLYDTPGQLELFIYSEAGRKFVRELSGS-FSCSLFLVDLTTVTDPESLLSAIMQDVI 147
gi 170291001  80 LIVDRSEDIVESLTSLDC---DTLIIDTPGQMEIFAFRPTGRALCERLSRGMRLLSIYLGDYDPKRDLEDLLSSAFLAKI 156
gi 240103994  77 RLLSEVGRIAREILKLDGe-rEYTLIDTPGQMESFLFHEFGVKLMESLS---DPLLAYLFDPEILKRPHDYCFVRFFALM 152
gi 284162041  75 LSLEHIDELMLEG--------DYIIYDTPGQMELFLYSKHGLAMAERIAKNDWCVCIFIIDAEVASTPENFASIVAQNAV 146
gi 288932506  77 MSLEILDEVIVEG--------EYVIYDTPGQMELFLYTDFGEKLVEKLNG--FTTGLFLIDSCLATSHEKFAACVAQAVV 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126466209 161 TQAKLGLTVVPVINKIDIAGSNELARLI--VEEPEKLAE-MAKHYSeegllseVVPELVSIALKTKGAyRPVMVSAKKTN 237
gi 119873431 173 VRVRFEIPLVTVLTKADLLDREFVERLRarVAQ------------GlggleedLVAELASIVDRLEKKqRLIKVSAITRE 240
gi 14521637  181 IDLRLGATTIPALNKVDLLSEEEKERHRkyFEDIDYLTArLKLDPSmq---glMAYKMCSMMTEVLPPvRVLYLSAKTRE 257
gi 18976856  152 IDLRLGATTVPALNKVDLLSEKEFERHKkyFEDIEYLTTkLKFDVStq---glLAYKMCQVFPELSPPvRVLYLSAKTGV 228
gi 14590504  156 IDLRLGATTVPALNKVDLLKEEQLEKHRkyFEDLDYLMGrLKFDPSmq---glMAYKMCSIMMEVLPPiRVLYLSAKTRE 232
gi 11498150  148 VSLRLSLPTLTAFTKSDVADVDVRSLLGeiKHREGVLAE--------------LMEKLVDFIELTTIPyRPIKISNIKKT 213
gi 170291001 157 LELKLGVKVIPVLNKSDLWGGRDFSDVWe-----AVLRGeMSVLEGrngvyadALQDLLKAISSFRSPiRVIPISAKYFQ 231
gi 240103994 153 IDLRLGTTTVPVLNKIDLLSEEELNRHKkyLEDIEYLTArLKFDPTmq---glLAYRMCSFLPEVSPPvRVVYASAKDGR 229
gi 284162041 147 ISLRLSMPTITVLNKCD-VADFDLKEVTskLGEVEGVLGeIVEK-------------LIGLIEYTTMRfRIIKISALKCV 212
gi 288932506 147 VTLRFSIPFVTIFTKSDLCEALSLKDVKkrISESEGMVAeVLEN-------------FLRFVDVTTLPqRIVRISSKDRR 213
                        250       260
                 ....*....|....*....|
gi 126466209 238 TMEDLHYLVHEAFCTCGDLT 257
gi 119873431 241 GFDDLQTILHEVFCTCGELT 260
gi 14521637  258 GFEDLETLAYEHYCTCGDLT 277
gi 18976856  229 GFEDLETLAYEHYCTCGDLT 248
gi 14590504  233 GFEDLETLAYEHYCTCGDLT 252
gi 11498150  214 GYEELFSALYELFCAAET-- 231
gi 170291001 232 GFGEVFDSLNEAWCSCGDMT 251
gi 240103994 230 GFDELETLSYEHYCTCGDLT 249
gi 284162041 213 GFENVLSAINEVFCSCGDLS 232
gi 288932506 214 GFDEVFGVIHEIFCSCGDIS 233
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap