Conserved Protein Domain Family
PRK13764

?
PRK13764: PRK13764 
ATPase; Provisional
Links
?
Statistics
?
PSSM-Id: 184311
View PSSM: PRK13764
Aligned: 87 rows
Threshold Bit Score: 697.743
Threshold Setting Gi: 305662526
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124486222   1 MILVPDTSVVIDGRVTALIEKGEYRDATIIIPEAVFAELEAQANQGREIGFSGLAELQKLCVLAKQG--R--ITLQYVGE 76
gi 145591597   2 DRYIADSSAVLDGTLKEVVVSGR-VRGTLFLLSEMVEYFTSLARQGDGIGIVGVEELKDLYEVVDKLglSdfVKIETVSL 80
gi 119871921   5 DKYIADSSVVLDGSLKEAILGGR-LRGTLFLLSEMAEYFSSLARQGDGVGIIGVEELKDLFESVEKLglSdfVKIEVVSI 83
gi 41614855    2 TIVVPDTSALIEKAISKMIKENKIKPSKIVIHNATIAELEHQANENREIGYLGLEEIETLKEMADQY--G--FTVEFQGE 77
gi 159040884   6 EIYIPDTSVFLDGSLKEYLQSNG-LKGRLLIHTGVVKYFEDDAKVGSSLGILGLEEVAAIHDMASK---IegITVEYVDV 81
gi 18313913    2 DKYVADTSVILDGTLKEAVVSGS-IRGTLFILSEAVEYFSSLARQGDGIGIVGMEELRDLYDVVEKLglGdlVKIEVVPA 80
gi 126459714   2 DKYVADSSVILDGSLKEAVVGGK-IRGTLFLLSELVEHFASLARQGDGIGIVAMEELRDIHEVVEKLglSdfLRVESVAA 80
gi 170291208   4 SIYVLSSDVLMRSLVRYEPGYSLIRGSKLIIPEEVLSKIEEDALSGDRFSVGALGEIIWLQDLGREG--Y--IEEVRVEE 79
gi 171186166   2 EKYVADSSVVLDGSLKEAVLGGR-IRGTLFLLSEMVEHFASLARRGDGIGLVGMEELRDLFESVEKLglGdfLKVEVVSV 80
gi 305662526   7 DVYIPDTTVIVERTLSKIIDRGL-IRGRILIPKEYIQFFESRARRGSAIGILGLEELVSIRNKAVERgvI--IDIIDSGY 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124486222  77 RPRLEQVKLAGGGEIDSMIRAVAIEHGATFLTSDYVQAEVARAKGLEVIYLKSEttdNFApLQIDEFFDE--NTFAVYLK 154
gi 145591597  81 NRKVDP------EELNIYARRFAKENGCIYITSDEVARDAARLQGVEVLYLGKT---REV-LTLERFFGP--EVMSVHLK 148
gi 119871921  84 DRRVDP------SELDMYARRFAKENNCIYVTSDELSRDAAVVQGIRTIYLGKP---RDV-LTIEKFFSK--DVMSVHLK 151
gi 41614855   78 RPKAEEIILAKKGEIDNKIRELAKQLNAILITADRTQYYVAKVLGIQAIFLEKP---KREkLLFEQYFDE--NTMSVHLK 152
gi 159040884  82 IPRSADL-----KDPESLVLNTARELGAVLITSDAMVKKVCEAMGIRYIYIGKG---TGA-LEIEKWFQKypDTMSIHLK 152
gi 18313913   81 GKRLDP------SELDVYARRFAKDNGYIYVTSDELARDTAFIEGVEVLYLGKT---RDV-LTIEKFFGP--EVMSVHLK 148
gi 126459714  81 GRRVE-------GDLDAYVRRFAKENGCIYVTSDELARDAAKAQGIEVLYLGKP---RDV-LTIEKFFDR--DVMSVHLK 147
gi 170291208  80 HR----------GKGIDALQELAKKFSAKVLTGDRITTLSLLARGVDVQYIGPR---MDG-LRIYDYFDE--ETMSVHLK 143
gi 171186166  81 GRRVEAE-----EELDAYVRRFARENGCVYVTSDELARDAAAVQGVKVLFLGRP---REV-LAIERFFSK--DVMSVHLK 149
gi 305662526  84 RETYSDIDQ---ERLDSIAMELARKLGAKLLTHDRFRQLACKAFGVEAMVLEYY---RDSsLWFEKYFDK--ETLSLHIK 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124486222 155 ERVAPCARKGTIKESRLVQIREAPATEYELRAIAQECLERAKRH-PDGFVEVEMPGVTVSQIGSMRITTTRPPFSDGIEV 233
gi 145591597 149 EGLPPLGKVGRPGNWRIVQLSSEPLSRKQLEIVVRELIAEASKLsPRTKIEIRRPHSLIIQHKEYRVVVVFPPVSERLEI 228
gi 119871921 152 EGLPPFGKVGKPGSWRFVQLSPEPLTRKQLYTIVRELVSEASRLnSKTRIEIRRPHSMIIQHKEHRIVVVFPPVSERLEI 231
gi 41614855  153 EGLPPLAKKGTPGKWELVRITDKPLTKNDLEEIIKEIAEEAVSR-EDSYIDIEGENILVAQIGKYRIVAVKPPLSDAIEV 231
gi 159040884 153 ENTLPMAKRGAPGNWELVYLDNKVLSKEYLERLVREVISTAYSGgNGAVIEVKRSHSLIVQYRDIRIVAVFPPVSDGIEI 232
gi 18313913  149 EGLPPMGKVGRPGSWKMVQLSQEPLTRKQLEIIVRELISEASRLnPRSKIEIRRPHSLIIQHKEYRIVIVFPPVSERLEI 228
gi 126459714 148 EGLPPFGKVGRPGNWKMVQLSQEPLSRKQLETIVRELVSEASRLtPRTKIEIRRPHSLIIQHKEYRIVVVFPPVSERLEI 227
gi 170291208 144 EGAPPMAKKGRPGNFRLVKLSDKKLEEFEVRTIAYEILERAKTG-IDAFIEVMYDDAYIIQLGDLRVLAAFPPFSDGIEI 222
gi 171186166 150 EGLPPYGKVGRPGSWRFVQLSPEPLDRRQLDVIVRELVSEAARLsPRTRVEIRRPHSLIIQHKDLRIIIVFPPVSERLEI 229
gi 305662526 156 EGAPILAKKGVPGNWRLVVVEEKIQRREDLEILLEEIVRRVRAG--EGIVEIERQGLLMIQLKDYRIIIVSPPIGIAYEI 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124486222 234 TVVRPTREVSFESYNYAAALKDRLKEGAGGMLIVGTPGSGKSTLEQNIAIYLGSQNFIVKTIESPRDLMVPDSITQYTSL 313
gi 145591597 229 TATKPVVRKKIEDYGLPPKVLERLEKSAEGILVAGAPGAGKTTFAQALAEFYLSKGKIVKTIESPRDMVLPPAITQISKN 308
gi 119871921 232 TATKPVVRKSIEDYGLDPRVLERLEKSAEGILIAGAPGAGKTTFAQALAEFYLSKGKIVKTLESPRDMTLSPAITQISKN 311
gi 41614855  232 TIVRPVKKLSLEDYKIREELLERLKEKAHGILIAGAPGMGKTTFAQALAMFYVKLNKVVKTIESPRDMDLGKEVTQYSLT 311
gi 159040884 233 TAVRPLVKKRVEEYNLHPKVVERLEKRAEGILIGGAPGAGKTTFAQALAEFFVSKNKVVKTIESPRDMVLPDQVTQLSKN 312
gi 18313913  229 TATRPVVRKKIEDYGLDPRVLERLEKSAEGILIAGAPGAGKTTFAQALAEFYLSKGKVVKTVESPRDMVLSPAITQLSKN 308
gi 126459714 228 TATRPVVRKRIEDYGLDPKVLERLEKSAEGILIAGAPGAGKTTFAQALAEFYLSRGKVVKTLESPRDMVLPPPITQLSKN 307
gi 170291208 223 TAVRPLVKVTLDDYNLSDKLKRRLSERAEGILIAGPPGAGKTTFASALAEFYKERGRIVKTLESPRDLQVGPEITQYGRL 302
gi 171186166 230 TAAKPVVRKSIWDYGLDGKVVERLEKSAEGILIAGAPGAGKTTFAQALAEFYLSKGKIVKTLESPRDMVLSPAITQISKN 309
gi 305662526 234 TITRPIVRLKLEDYELPSKLIKRLEERAEGILIAGAPGMGKTTFAQALAEYYDRKGKIVKTIESPRDMKLPPTVSQYSKS 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124486222 314 DGSIAATGEVLTLLRPDYVIFDEMRRSEELSVFADLRLSGIKVIGGLHAKSALDAMIRLASLVDLNLIPQIVATMVFVKT 393
gi 145591597 309 LATSEEIHDLLLLSRPDYTIFDEMRDTADFQLYVDLRLAGVGMVGIVHATSPIDAIQRFIRRVELGMIPSIIDTVIFMKD 388
gi 119871921 312 LATSEEVHDILLLSRPDYTIFDEMRDTADFQLYVDLRLAGVGMVGVVHATSPIDAIQRFIRRVELGMIPSIIDTVIFMKD 391
gi 41614855  312 QGKTREIYALLLLARPDYVLFDEVRTERDIKLFADLRLAGIGMIGVIHANRAIDAIQRFIGKIELGVIPQVVDTVIFIDK 391
gi 159040884 313 LATPEELHDILLLSRPDYTIFDEMRDTADIQLYVDLRLAGIGMVGVIHATSPIDSIQRFIGRVELGMLPSIVDTVIFIDK 392
gi 18313913  309 LATSEEIHDLLLLSRPDYTIFDEMRDTADFQLYVDLRLAGVGMVGVVHATSPIDAIQRFIRRVELGMIPSIIDTVIFMKD 388
gi 126459714 308 LATSEEVHDILLLSRPDYTIFDEMRDTADFQLYVDLRLAGVGMVGVVHATSPIDAIQRFIRRVELGMIPSIIDTVIFMKD 387
gi 170291208 303 AGSFENTADLLLLVRPDYVIFDEMRKTQDFKIFVDMRLAGVGMVGVVHCGFPIEAIQRFIDRVDLGVLPHVVDTVIFIKD 382
gi 171186166 310 LATSEEVHDILLLSRPDYTIFDEMRDTADFQLYVDLRLAGVGMVGVVHATSPIDAVQRFIRRVELGMIPSIIDTVIFMKD 389
gi 305662526 314 YASSRELHDILLLSRPDYTVFDEMRDDEDFKIYVDLRLAGIGMIGVVHATSPIDAIQRFIGRIDIGMIPSVIDTVIFIDK 393
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124486222 394 GDISEIYNVSTGFGVPKALEqiGDPQIRPIVRLTNIITQETAAEAFRYEGEVMVTPAaglskvspvvipkaapaptlapv 473
gi 145591597 389 GEVRKVYALSMVVKVPAGMR--EEDLARPVILVKDFITDEVEYEIYVFGEETFVVPVk---------------------- 444
gi 119871921 392 GEVKKIYALSMVVKVPAGMR--EEDLARPVILVKDFLTDEVEYEIYVFGEETFVVPV----------------------- 446
gi 41614855  392 GQIAKVYTLDMVVKVPTGMK--EEDLARPVIEVRDLYTGKLEYEIYVFGEETVVMPI----------------------- 446
gi 159040884 393 GLVSKVYSLEMTVKIPAGLK--EEDLARPVVVVKDFITEEPEYEVYVFGEETFVVPL----------------------- 447
gi 18313913  389 GEVRKIYALSMVVKVPAGMR--EEDLARPVILVKDFLTDEVEYEIYVFGEETFVVPV----------------------- 443
gi 126459714 388 GEVRKVYALSMVVKVPAGMR--EEDLARPVILVKDFLTGEVEYEIYVFGEETFVVPV----------------------- 442
gi 170291208 383 GKVEKVYSLKITVKMPTGMK--DVALARPVVLVKDFETETVEYEIYTFGEEVIVMPV----------------------- 437
gi 171186166 390 GEVKKIYALSMVVKVPAGMR--EEDLARPVILVKDFLTDEVEYEIYVFGEETFVVPV----------------------- 444
gi 305662526 394 GRVAKVYEISLTVKLPTGLR--EADLARPVVEVRDFLSGELEYEIYVFGEQTVVVPV----------------------- 448
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124486222 474 aeskapapvstvpeqssqeersappvhsmptFEVTDDNPAWVVLEKEIQNEIRRFTEGDIVVRMI-TDTKAAVYIEDADV 552
gi 145591597 445 -------------------------------RGEAVAMGPSRKVYSMVVSALKRYVp-PHEIKLEeRDGVIVVKVPEEYL 492
gi 119871921 447 --------------------------------KRGGERAPSRKIYSMVVSALKRYVp-PGEIKLEeRDGLIVIKVPEEYL 493
gi 41614855  447 -------------------------------HGEQMPNALARLAKIAIENEIKRFLKTDVKVEIE-SPNRVTVYVPKGYR 494
gi 159040884 448 ---------------------------------KRRSVEVNKRAMNQLLKVVGKYVp-LDQVIVEpREDVLVIKVPQEYY 493
gi 18313913  444 -------------------------------KRGEAGKAPSRKIYSMVISALKRYVp-PSEIRLEeRDGLIVIKVPEEYL 491
gi 126459714 443 -------------------------------KRGEEGRAPSRKVYSMVISALKRYVp-PSEIKLEeRDGVVVVKVPEEYL 490
gi 170291208 438 ------------------------------------------------------------------SAKEPAVE------ 445
gi 171186166 445 --------------------------------KRGEERAPSRKIYSMVVSALKRYVp-PGEIKLEeRDGLIVIKVPEEYL 491
gi 305662526 449 ------------------------------------KRIKGEIASDRVMNIVKKIIp---YADVAlENDTIIITLPRTLY 489
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124486222 553 PAAIGKAGKNIAAVVSKVGVGIDVRPLSDlpgrevlfndvpapvSGSAGFKIKSEKKQLSIICPDYAGKIVDLFSGKEYL 632
gi 145591597 493 GVVLSRGVTKLEKIRRKLSVDFRIEPR----------------------------------------------------- 519
gi 119871921 494 GVVLSRGVAKLEKLRRKLSLDFRIEPR----------------------------------------------------- 520
gi 41614855  495 KRLVGKRGKTIESFEKMLGVRITVKEIGE---------------EEPEFNIKETNKYLIIELPPEYYRRVVTILINGRPF 559
gi 159040884 494 GLVLSKGLPRIGRIKRRFRVDVRIEPRQ---------------------------------------------------- 521
gi 18313913  492 GVVLSRGVTKLEKLRRKLSIDFRIEAR----------------------------------------------------- 518
gi 126459714 491 GVVLSRGVTKLEKLRRKLALDFRIEPR----------------------------------------------------- 517
gi 170291208 446 --------------------------------------------GAPKFRLKRRKHTIILDLGPAMSDTEVTIYSGEREM 481
gi 171186166 492 GVVLSRGVTKLEKLRRKLSVDFRIEPR----------------------------------------------------- 518
gi 305662526 490 TNSTMKLIRKVKKRLDRLGYNIDIKLT----------------------------------------------------- 516
                        650       660       670
                 ....*....|....*....|....*....|....*...
gi 124486222 633 FTATVDDYGEIHLARNSSIAMEMIRRYGADEELKIRPV 670
gi 145591597     --------------------------------------
gi 119871921     --------------------------------------
gi 41614855  560 VDAIVGKDGKIKIAKNSDLGKVLYNALKGGAKIDIELK 597
gi 159040884     --------------------------------------
gi 18313913      --------------------------------------
gi 126459714     --------------------------------------
gi 170291208 482 ATLVTDSRGRITLAKSSPLGRRVLEAIRNESLRIIPGE 519
gi 171186166     --------------------------------------
gi 305662526     --------------------------------------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap