Conserved Protein Domain Family
PRK13557

?
PRK13557: PRK13557 
histidine kinase; Provisional
Statistics
?
PSSM-Id: 237425
View PSSM: PRK13557
Aligned: 28 rows
Threshold Bit Score: 980.311
Threshold Setting Gi: 300311768
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
285018414   3 ASDSSPDHSLPVSVDSDAPTGVSNRSSDIFFAAVQTTRMPMIVTDPNQPDNPIIFVNNAFLEMTGYSKEELIGNNCRFLQ 82 
21231858    1 MNDSGYGEPRAPLIGESQTLPVSKHRSDIFFAAVETTRMPMTVTDPYLPDNPIVFANRAFLEMTGYAADEIIGNNCRFLQ 80 
84624645    1 MNDRVHGELRAPHISESRSLPVEKHRSDIFFAAVETTRMPMTVTDPHLPDNPIVFANRAFLEMTGYSAEEVIGNNCRFLQ 80 
78048310    1 MNDPGHGELRAPQISDTRGLPVEKHRSDIFFAAVETTRMPMTVTDPHLPDNPIVFANRAFLEMTGYAADEVIGNNCRFLQ 80 
66045936    1 ------MSENKTRVDNAATGDIKHQGKDIFFAAVETTRMPMIVTDPNRPDNPIIFANRAFLEMTGYASEEIIGSNCRFLQ 74 
120612211   3 SEKPPITGQARPFVAEGAPNEVAEHKDDIFFAAIETTRMPMLVTDPRQPDNPIVFCNRAFVAMTGYQPQDILGHNCRFLQ 82 
66768015    1 MNDSGYGEPRAPLIGESQTLPVSKHRSDIFFAAVETTRMPMTVTDPYLPDNPIVFANRAFLEMTGYAADEIIGNNCRFLQ 80 
188577558   1 ---------------------------------METTRMPMTVTDPHLPDNPIVFANRAFLEMTGYSAEEVIGNNCRFLQ 47 
188991140   1 MNDSGYGEPRAPLIGESQTLPVSKHRSDIFFAAVETTRMPMTVTDPYLPDNPIVFANRAFLEMTGYAADEIIGNNCRFLQ 80 
186477108   1 -----MDTNLTVTTIRSGAHRITDHQDDIFFAAVSTTRMPMVVTDPHLPDHPVIFANHAFLRMTGYELTEIIGSNCRFLQ 75 
285018414  83 GPDTDRETVRSVRDAIASHTEVAVEILNYRKDGSSFWNALYISPVYDECGKLVYFFGSQLDVSRRRDAEDALRQAQKMEA 162
21231858   81 GPETDRQAVADVREAIDNRREFATEVLNYRKDGSTFWNALFVSPVFDDTGKLVYFFGSQLDVSRRRDAEDALRQAQKMEA 160
84624645   81 GPETDPASISDVRQSIETRSEFATEVLNYRKDGSSFWNALFVSPVFDDHGNLVYFFGSQLDVSRRRDAEDALRQAQKMEA 160
78048310   81 GPDTDPASISDVRASIESRSEFATEVLNYRKDGSSFWNALFISPVFDDKGNLVYFFGSQLDVSRRRDAEDALRQAQKMEA 160
66045936   75 GPDTDRTAVQSIRDAIDQRVDISTEILNYRKDGSSFWNALFISPVYNDAGELIYFFASQLDISRRRDAEEALRQAQKMEA 154
120612211  83 GPATDRNTVAALREAIDQRREISLELLNYRKDGSTFWNALFISPVYNARGELVYFFASQLDVSRRRDAEEALSQAQKMEA 162
66768015   81 GPETDRQAVADVREAIDNRREFATEVLNYRKDGSTFWNALFVSPVFDDTGKLVYFFGSQLDVSRRRDAEDALRQAQKMEA 160
188577558  48 GPETDPASISDVRQSIETRSEFATEVLNYRKDGSSFWNALFVSPVFDDHGNLVYFFGSQLDVSRRRDAEDALRQAQKMEA 127
188991140  81 GPETDRQAVIDVREAIDNRREFATEVLNYRKDGSTFWNALFVSPVFDDTGKLVYFFGSQLDVSRRRDAEDALRQAQKMEA 160
186477108  76 GPETDRATIDEVRAAVADRRELATEILNYRKDGSTFWNALFISPVFNEQGELVYFFGSQLDVSRRRDAEDALHQAQKMEA 155
285018414 163 LGQLTGGIAHDFNNLLQIMSGYLELIEHAVQGESSTPLLLSKSVERARDAASQAARLTQQLLAFARKQKLEGRVLNLNAL 242
21231858  161 LGQLTGGIAHDFNNLLQVMSGHLEFIQMMVSNGNGSPDRIAVSAEHAAAAAAKAATLTQQLLAFSRKQKLRGRVVNLNGL 240
84624645  161 LGQLTGGIAHDFNNLLQVMSGHLEVIQMMASAGAGNAERIAFSAEHAAAAAAKAATLTQQLLAFSRKQKLRGRVVNLNGL 240
78048310  161 LGQLTGGIAHDFNNLLQVMSGHLEVIQMMASAGAGNAERIAFSAEHAAAAAAKAATLTQQLLAFSRKQKLRGRVVNLNGL 240
66045936  155 LGQLTGGIAHDFNNLLQVMGGYIDLIGSAAEKPVIDVQRVQRSVHHAKSAVERASTLTKQLLAFARKQKLQGRVLNLNGL 234
120612211 163 LGQLTGGISHDFNNLLQVMSGHLDVMRVRNRSQKLGREDIDRSIDSIRSAVGKASTLTQQLLAFSRKQKLQGRVVSLNAL 242
66768015  161 LGQLTGGIAHDFNNLLQVMSGHLEFIQMMVSNGNGSPDRIAVSAEHAAAAAAKAATLTQQLLAFSRKQKLRGRVVNLNGL 240
188577558 128 LGQLTGGIAHDFNNLLQVMSGHLEVIQMMASAGAGNAERIAFSAEHAAAAAAKAATLTQQLLAFSRKQKLRGRVVNLNGL 207
188991140 161 LGQLTGGIAHDFNNLLQVMSGHLEFIQMMVSNGNGSPDRIAVSAEHAAAAAAKAATLTQQLLAFSRKQKLRGRVVNLNGL 240
186477108 156 LGQLTGGIAHDFNNLLQVMAGYVDVLQMGIE-GHAQSAVMAQSLDRIRGAVAKATTLTQQLLAFARKQKLVGRTVNLNTL 234
285018414 243 VAGMSDVAKRTLGDSIAFSLELASDLRNCRIDPTQAEVALLNILINARDAMAEQSVprLVIQTRNVSVRVNEPTTYDNLL 322
21231858  241 VSGMNNMAERALGGGITLRQALEERLWNCQIDTTQAEVALLNVLINARDAMANAERkeVMVQTQNVEITSHDLSMYHQLA 320
84624645  241 VSGMNNMAERALGGGITLRQSLEEGLWNCQIDTTQAEVALLNVLINARDAMAQAERkeVTVQTQNVEVTTHDLAMYHQLA 320
78048310  241 VAGMTNMAERALGGGVTLRQALEEGLWNCQIDTTQAEVALLNVLINARDAMAQAERkeVTVQTQNVEISGHDLAMYHQLS 320
66045936  235 VSTTEPLIERTFGPEVIIETDLDPALKNCRIDPTQAEVALLNIFINARDALIGRLNpkIFIETRNLVVDELANMSYDGLL 314
120612211 243 ATGMASLAERTLGEAIEIDYVLGDDVPNCELDTTQLEVAVLNLLLNSRDAMPNGGR--IRVETRGIELHAQDGHAFSGLP 320
66768015  241 VSGMNNMAERALGGGITLRQALEERLWNCQIDTTQAEVALLNVLINARDAMANAERkeVMVQTQNVEITSHDLSMYHQLA 320
188577558 208 VSGMNNMAERALGGGITLRQSLEEGLWNCQIDTTQAEVALLNVLINARDAMAQAERkeVTVQTQNVEVTTHDLAMYHQLA 287
188991140 241 VSGMNNMAERALGGGITLRQALEERLWNCQIDTTQAEVALLNVLINARDAMANAERkeVMVQTQNVEITSHDLSMYHQLA 320
186477108 235 ADGMVELARRTLGGNISLKTEYEEGLGNCRVDSTQLEVALLNVLLNARDALASRRDgvVTVRTETVELEQQETVGFADLR 314
285018414 323 PGHYVCVSVTDNGSGMPPEVLARVLDPFFTTKDEGKGTGLGLSMVYGFAKQSGGAVRLYSEEGHGTTVRLYFPIDDNVEN 402
21231858  321 PGRYVSIAVTDSGSGMPPEVVSRVMEPFFTTKEEGQGTGLGLSMVYGFVKQSGGTVRIYSEVGEGTTVRLYFPASSDYEN 400
84624645  321 PGRYVSIAVSDTGSGMPPEVVSRVMEPFFTTKDEGQGTGLGLSMVYGFVKQSGGTVRIYSEVGEGTTVRLYFPASSKFEN 400
78048310  321 PGRYVSIAVTDTGSGMPPEVVSRVMEPFFTTKEEGQGTGLCLSMVYGFVKQSGGTVRIYSEVGEGTTVRLYFPASSEFEN 400
66045936  315 PGRYVSIAVTDNGIGMPASIRDRVMDPFFTTKEEGKGSGLGLSMVYGFAKQSGGAARIYTEEGVGTTLRLYFPVDEAVLS 394
120612211 321 PGRYATLSVTDTGSGIPADMVPRVMDPFFTTKEEGKGTGLGLSMVYGFAKQSGGAVTIYSEVGVGTTVRMYFPAVHGRTH 400
66768015  321 PGRYVSIAVTDSGSGMPPEVVSRVMEPFFTTKEEGQGTGLGLSMVYGFVKQSGGTVRIYSEVGEGTTVRLYFPASSDYEN 400
188577558 288 PGRYVSIAVSDTGSGMPPEVVSRVMEPFFTTKDEGQGTGLGLSMVYGFVKQSGGTVRIYSEVGEGTTVRLYFPASSKFEN 367
188991140 321 PGRYVSIAVTDSGSGMPPEVVSRVMEPFFTTKEEGQGTGLGLSMVYGFVKQSGGTVRIYSEVGEGTTVRLYFPASSDYEN 400
186477108 315 SGCYVTIAISDNGCGIPPEILDRVMDPFFTTKGEGKGTGLGLSMVYGFAKQSGGAVNLYSEPGVGTTLRLYFPAVGGIAQ 394
285018414 403 MAPrdSRARRPFDRQGDETILIVEDRPDIADLARLFLEDQGYVTHVVYNAREALAL---IDTGIHVDLLYSDLIMPGGLN 479
21231858  401 ALP--STKNRALDKGGNETILIVEDKEDVAVVAKMFLEGAGYRALSASSGREAIEV---LEQHPEVDALFTDLIMPGGMN 475
84624645  401 DLQ--AAKSRAIDKGGNETILVVEDKQDVAVVARMFLENAGYRILSASSGREAVEV---LGKNPEVDALFTDLIMPGGMN 475
78048310  401 DLQ--AAKSRAIDKGGNETILVVEDKQDVAVVARMFLENAGYRVLSASSGREAMEI---LEKTPQVDALFTDLIMPGGMN 475
66045936  395 KND--PPKASERRIGSSERILIVEDRPDVAELAKMVLDDYGYVSEIVLNAREALKR---FEAGATYDLLFTDLIMPGGMN 469
120612211 401 PEL--VESLAPHARGGTETVLVVDDRVEVADLAQAMLEGLGYTVHVAHSAHAALKLvrsLEPSALPHLLFTDVVMPGGLN 478
66768015  401 ALP--STKNRALDKGGNETILIVEDKEDVAVVAKMFLEGAGYRALSASSGREAIEV---LEQHPEVDALFTDLIMPGGMN 475
188577558 368 DLQ--AAKSRAIDKGGNETILVVEDKQDVAVVARMFLENAGYRILSASSGREAVEV---LGKNPEVDALFTDLIMPGGMN 442
188991140 401 ALP--STKNRALDKGGNETILIVEDKEDVAVVAKMFLEGAGYRALSASSGREAIEV---LEQHPEVDALFTDLIMPGGMN 475
186477108 395 RRP---SAPKAIEKAGNEMILIVDDRVEVAEVAQAMLEQIGYRTRVVLNTKEAMDI---LQEGAHLDLLFTDLIMPGNMN 468
285018414 480 GVMLAREVRRRQPRIKVLLTTGYAESSIERTDAGGNEFEVLAKPYNRQELTRKVRMVLDGPNGTE 544
21231858  476 GVVLAREARRMLPKIKVLLTTGYADASIQRTDVGGAEFDVVNKPYTQKELLKRIRMLLDGPTGVG 540
84624645  476 GVMLAREARRMLPKIKILLTTGYADASIQRTDVGGAEFDVVNKPYTQKELLKRIRMLLDGPTGVG 540
78048310  476 GVMLAREARRMLPKIKILLTTGYADASIQRTDVGGAEFDVVDKPYTQKELLKRIRMLLDGPTGVG 540
66045936  470 GVMLAREVRRRFPKVKVLLTTGYAESSIERTDIGGSEFEVVSKPCMPQDLARKVRQVLDGPNGIA 534
120612211 479 GYELAREMRKTVAGIHILLTTGFDRDMGSLANVAPTEFEILKKPYRLADLARRVRMVLDGATGTK 543
66768015  476 GVVLAREARRMLPKIKVLLTTGYADASIQRTDVGGAEFDVVNKPYTQKELLKRIRMLLDGPTGVG 540
188577558 443 GVMLAREARRMLPKIKILLTTGYADASIQRTDVGGAEFDVVNKPYTQKELLKRIRMLLDGPTGVG 507
188991140 476 GVVLAREARRMLPKIKVLLTTGYADASIQRTDVGGAEFDVVNKPYTQKELLKRIRMLLDGPTGVG 540
186477108 469 GVMLAREARRLHPKIKVLLTTGYADASMERTDANGSEFDIIHKPYRRAELARKVRIVLNGPTGVG 533
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap