Conserved Protein Domain Family
PRK13543

?
PRK13543: PRK13543 
cytochrome c biogenesis protein CcmA; Provisional
Statistics
?
PSSM-Id: 184129
View PSSM: PRK13543
Aligned: 16 rows
Threshold Bit Score: 349.147
Threshold Setting Gi: 170730723
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15839046    9 DDRPPSSAPPLLAAHALTYSRNATPILGPLHFHINPGEALIVQGPNGIGKTTLLRILAGLLHSDSGHIDINTHHNTTApE 88 
28199356    1 MTALPSSAPPLLAAHALTYSRNAIPILGPLHFHINPGEALIVQGPNGIGKTTLLRILAGLLHSDSGHIHINTHHNTTApE 80 
58581778   19 MIEPLHTAPPLLAAHALAFSRNEEPVFGPLDFHVDAGEALLVQGDNGAGKTTLLRVLAGLLHVEHGQIQIDGKTAKRG-D 97 
78048078    1 MIEPLHTAPPLLAAHALAFSRNEEPVFGPLDFHVDAGEALLVQGDNGAGKTTLLRVLAGLLHVERGQIQIDGKTAKRG-D 79 
84623681    1 MIEPLHTAPPLLAAHALAFSRNEEPVFGPLDFHVDAGEALLVQGDNGAGKTTLLRVLAGLLHVEHGQIQIDGKTAKRG-D 79 
188576859   1 MIEPLHTAPPLLAAHALAFSRNEEPVFGPLDFHVDAGEALLVQGDNGAGKTTLLRVLAGLLHVEHGQIQIDGKTAKRG-D 79 
188576668   1 MIEPLHTAPPLLAAHALAFSRNEEPVFGPLDFHVDAGEALLVQGDNGAGKTTLLRVLAGLLHVEHGQIQIDGKTAKRG-D 79 
182682082   1 MTALPSSAPPLLAAHALTYSRNAIPILGPLHFHINPGEALIVQGPNGIGKTTLLRILAGLLHSDSGHIHINTHHNTTApE 80 
190575153   1 -----MNTPALLAASGLSFSRNDEPVFGPLDFHVDAGEALLVQGGNGAGKTTLLRVLAGLARPGAGQVRIDGKPASNA-E 74 
194366472   1 -----MNTPALLAASGLSFSRNDEPVFGPLDFHVDAGEALLVQGGNGAGKTTLLRVLAGLARPGAGQVQIDGRPAGNA-D 74 
15839046   89 RTRHIAYLSHLPGLKQDLSALENLHFLNALHGYHPQRTPSNALTLVGLTDHAQTLVRQLSAGQKKRLSLAQLWLSPAPLW 168
28199356   81 RTRHIAYLSHLPGLKQDLSALENLHFLNALHGCHPQRTPSNALTIVGLTDHAQTLVRQLSAGQKKRLSLARLWLSPAPLW 160
58581778   98 RSRFMAYLGHLPGLKADLSTLENLHFLCGLHGRRAKQMPGSALAIVGLAGYEDALVRQLSAGQRKRLALARLWLSPAPLW 177
78048078   80 RSRFMAYLGHLPGLKADLSTLENLHFLCGLHGRRAKQMPGSALAIVGLAGYEDALVRQLSAGQRKRLALARLWLSPAPLW 159
84623681   80 RSRFMAYLGHLPGLKADLSTLENLHFLCGLHGRRAKQMPGSALAIVGLAGYEDALVRQLSAGQRKRLALARLWLSPAPLW 159
188576859  80 RSRFMAYLGHLPGLKADLSTLENLHFLCGLHGRRAKQMPGSALAIVGLAGYEDALVRQLSAGQRKRLALARLWLSPAPLW 159
188576668  80 RSRFMAYLGHLPGLKADLSTLENLHFLCGLHGRRAKQMPGSALAIVGLAGYEDALVRQLSAGQRKRLALARLWLSPAPLW 159
182682082  81 RTRHIAYLSHLPGLKQDLSALENLHFLNALHGCHPQRTPSNALTIVGLTDHAQTLVRQLSAGQKKRLSLARLWLSPAPLW 160
190575153  75 RARYVAYLSHLPALKPDLDTLENLHFLCGLHGRRARQMPGNALAIVGLAGYEDTLVRHLSAGQKRRLALARIWLSPAPLW 154
194366472  75 RARYVAYLSHLPALKPDLDTLENLHFLCGLHGRRARQMPGNALAIVGLAGYEDTLVRHLSAGQKRRLALARIWLSPAPLW 154
15839046  169 LLDEPYANLDPEGITLLNHILTAHIHTQGGTLLTTPGARPTLPVPTRLLHLKKAP 223
28199356  161 LLDEPYANLDPEGITLLNHILTTHLHTQGGTLLTTPGALPTLPVPTRLLHLQKAP 215
58581778  178 LLDEPYANLDLDGITLVNRMISAHLRGGGAALVTTHGAYAAPPVRTRMLTLEAAA 232
78048078  160 LLDEPYANLDLDGITLVNRMISAHLRGGGAALVTTHGAYAAPPVRTRMLTLEAAA 214
84623681  160 LLDEPYANLDLDGITLVNRMISAHLRGGGAALVTTHGAYAAPPVRTRMLTLEAAA 214
188576859 160 LLDEPYANLDLDGITLVNRMISAHLRGGGAALVTTHGAYAAPPVRTRMLTLEAAA 214
188576668 160 LLDEPYANLDLDGITLVNRMISAHLRGGGAALVTTHGAYAAPPVRTRMLTLEAAA 214
182682082 161 LLDEPYANLDPEGITLLNHILTTHLHTQGGTLLTTPGALPTLPVPTRLLHLQKAP 215
190575153 155 LLDEPYANLDLEGITLVNRMISAHLRAGGAALVTTHGAYAAPPVRTRQLDLGGAA 209
194366472 155 LLDEPYANLDLEGITLVNRMISAHLRAGGAALVTTHGAYAAPPVRTRQLDLGGAA 209
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap