Conserved Protein Domain Family
atpC

?
PRK13449: atpC 
F0F1 ATP synthase subunit epsilon; Provisional
Statistics
?
PSSM-Id: 184058
View PSSM: PRK13449
Aligned: 13 rows
Threshold Bit Score: 124.884
Threshold Setting Gi: 302381247
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56551138   1 MAELHYELVTPSRLARSGDAFMVVVPGTEGDLGVMAGHMPTMTAIRDGEVAIYssEHQIETKFHISGGFAEINEKGLIIL 80
gi 197103704  2 ADKLHFSLVSPERELFSGLVDQVDAPGSEGDFGVLAHHAPFMTTLKEGQVRVY--VDGKVTVYEVRGGFADVTPEGLTIL 79
gi 221236494  1 MAKLHFSLVAPERELFSGEVDMVQAPGAEGDFGVLANHAPFMTTLREGKVTVK--DGATTKVFDIQGGFADVGPEGLTIL 78
gi 167648690  1 MAKLHFSLVAPERELFSAEVDQVDAPGAEGDFGVLPGHAPFMTTLREGKVTVR--DGSKLRVFDIQGGFADVGPDGFTIL 78
gi 295687684  1 MAKLHFSLVAPERELFSGEVDMVQAPGAEGDFGVLANHAPFMTTLREGKVTVK--DGATTKVFDIQGGFADVGPDGLTIL 78
gi 16127675   1 MAKLHFSLVAPERELFSGEVDMVQAPGAEGDFGVLANHAPFMTTLREGKVTVK--DGATTKVFDIQGGFADVGPEGLTIL 78
gi 260753211  1 MAELHYELVTPSRLARSGDAFMVVVPGTEGDLGVMAGHMPTMTAIRDGEVAIYssEHQIETKFHISGGFAEINEKGLIIL 80
gi 85374585   1 -MALHFELVTPERQVRSEDVHMVVVPGSEGEFGVLEGHAPFMSTIRDGAVQVFktEGATPEEIMVEGGFAEVGENGLTVL 79
gi 148553548  1 MADLHFELVTPERLLRSEEVHMVVVPGSEGDFGVLAGHAPFMSTVRSGELAIYssPTTVAARIHVEGGFAEVNEKGLTVL 80
gi 302381247  2 AGKLSFSLVSPEREVFSGLVDQVDAPGVEGDFGVLADHAPFMTALREGPVVVF--DGSSRRTFTVRGGFADVTPAGLSIL 79
gi 294012672  1 -MALHFELVTPEKLVRSEEVYQVVVPGTDGDFGVLEGHAPFMSTVRDGAIQVFasAGAAPEVIPVRGGFAEVNEKGLTVL 79
gi 87200416   1 -MSLHFELVTPARLVRSEEVHMVVVPGTDGEFGVLEGHAPFMSTVKDGAIKVYrsAGAAPEEIQVQGGFAEVSAKGLTVL 79
gi 103487770  3 KMALKFELVTPARLERSADVHMVTVPGTEGDFSVLEGHAPFMATLRNGPLTIYaaAGAAPEVIEVEGGFAEVNEAGLTVL 82

                ....*...
gi 56551138  81 AEEAKEEN 88
gi 197103704 80 AEHAQEAA 87
gi 221236494 79 AEHAVEAA 86
gi 167648690 79 AEHAVEAA 86
gi 295687684 79 AEHAVEAA 86
gi 16127675  79 AEHAVEAA 86
gi 260753211 81 AEEAKEEN 88
gi 85374585  80 AEKVTE-- 85
gi 148553548 81 AEQATEA- 87
gi 302381247 80 AEEATEIA 87
gi 294012672 80 AEHAG--- 84
gi 87200416  80 AEHVEG-- 85
gi 103487770 83 AEHIAG-- 88
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap