Conserved Protein Domain Family
fkp

?
PRK13412: fkp 
bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional
Links
?
Statistics
?
PSSM-Id: 237379
View PSSM: PRK13412
Aligned: 7 rows
Threshold Bit Score: 1403.04
Threshold Setting Gi: 116619704
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29347538    32 MQKLLSLPPNLIDSFHQLEEVNHTDW-----------------FCTSDPVGSKLGSGGGT-----TWLLQACHQAFAP-E 88  
60682086     1 MQKLLSLPSNLVQSFHELERVNRTDW-----------------FCTSDPVGKKLGSGGGT-----SWLLEECYNEYSD-G 57  
53713878     1 MQKLLSLPPNLVQSFHELERVNRTDW-----------------FCTSDPVGKKLGSGGGT-----SWLLEECYNEYSD-G 57  
150004170    1 MKKLLSLPPNLVECFHDIEKADQTEW-----------------FCTSDPIGSKLGSGGGT-----AWLLEACCQKVAP-D 57  
294672915    1 MKKLLSLPPNLVDSFHDVTGLSREEY-----------------FCTNDPVGHKLGSGGGT-----TWLLQACMTTED--G 56  
116619704   32 TASAQPWWTSVILTASSKRQADRYEWeiqrraeagkipgnvtyLVVPDFADQRIGSGGATlnalrGWITRTLFRNGSAlP 111 
150008207   26 MKKLLSLPPNLVDCFHAIEHVSTEEW-----------------FCTSDPVGARLGSGGGT-----TWLLEASRRKEAP-D 82  
29347538    89 ETFSKWIGNEKKILLHAGGQSRRLPGYAPSGKILTPIPVFS-WERGQKLGQNLLSLQLPLYERIMKQAPKGLNTLIASGD 167 
60682086    58 ATFGEWLEKEKRILLHAGGQSRRLPGYAPSGKILTPVPVFR-WERGQHLGQNLLSLQLPLYEKIMSLAPDKLHTLIASGD 136 
53713878    58 ATFGEWLEKEKRILLHAGGQSRRLPGYAPSGKILTPVPVFR-WERGQHLGQNLLSLQLPLYEKIMSLAPDKLHTLIASGD 136 
150004170   58 SDFLTWLGKEKRILLHAGGQSRRLPGYAPSGKILTPIPVFR-WARGQRLSQNLLSLQLPLYEQIMEKAPSSLHTLIASGD 136 
294672915   57 TSLAEWLPREKRILLHAGGQSRRLPSYAPSGKILTPVPVFR-WERGQRLSQDLLSLQLPLYEQMMDMAPEGIHTMVVSGD 135 
116619704  112 GDLTDWWQSQRVLMIHAGGDSRRLPQYSLSGKLFSAVPVTTpWGEASTVFDEMMALSTAWVERLSS------GLVVGSGD 185 
150008207   83 VSVEEWLGQEKRILLHAGGQSRRLPGYAPSGKILTPIPVFR-WARGQRLSQNLLSLQLPLYERIMKKAPESLHTLIASGD 161 
29347538   168 VYIRSEKPLQDIPEVDVVCYGLWVNPSLATHHGVFVSDRKKPEVLDFMLQKPSLEEL---EGLSKTHLFLMDIGIWILSD 244 
60682086   137 VYIRSEKPLQSIPEADVVCYGLWVDPSLATHHGVFASDRKHPEQLDFMLQKPSLAEL---ESLSKTHLFLMDIGIWLLSD 213 
53713878   137 VYIRSEKPLQSIPEADVVCYGLWVDPSLATHHGVFASDRKHPEQLDFMLQKPSLAEL---ESLSKTHLFLMDIGIWLLSD 213 
150004170  137 VYIRAGQPLQTIPDADVVCYGLWVDPNLAKNHGVFVSSRATPDKLDFMLQKPSVEEL---GKLMQTHLFLMDIGIWLLSD 213 
294672915  136 VLVRTSQPLQPIPDADVVCYGLWLDASVAKNHGVFVSSRKSPQVLKHMLQKPSIETL---NELQKDHYYLTDIGIWMLSD 212 
116619704  186 VILTFDAAEVDWSRAGVSGVAMLQPAVTGTQHGVYVTNDQ--GRIYAFLQKPSLSELsasGGLLKNDQVALDTGLMRFAP 263 
150008207  162 VYIRANQPLQEIPEVDVVCYGLWVEPSLAKNHGVFVSSRKSPDTLDFMLQKPSLETL---GELAGSHLFLMDIGIWLLSD 238 
29347538   245 RAVEVLMKRSLKE-----------------GTNDISYYDLYSDYGLALGEHPQTTDDEVNKLSVAILPLP---------G 298 
60682086   214 RAVEILMKRSHKE-----------------SSEELKYYDLYSDFGLALGTHPRIEDEEVNTLSVAILPLP---------G 267 
53713878   214 RAVEILIKRSHKE-----------------SSEELKYYDLYSDFGLALGTHPRIEDEEVNTLSVAILPLP---------G 267 
150004170  214 RAVSLLVKRSYKE-------------------GKLSYYDMYSDFGLTLGEHPRMMDDELNKLSVAILPLP---------G 265 
294672915  213 KAVELLAKKSMADpngplsmvrsssaglqgKNGQLKEYDMYSEFGCALGTNPSLPDDDLKDLKVAIVPLQ---------G 283 
116619704  264 ETAARLTRLAGVTeadgvialgpgvidgslDGGKPVAIDLYEHVTMALTGQWTPGEHDAPALHALAGALKetpfwcsvvS 343 
150008207  239 KAVRLLMKHSYTE-----------------DGKAMKAYDLYAEFGLALGKNPRITDSELNQLSVAILPLP---------G 292 
29347538   299 GEFYHFGTS---RELISSTLAIQDKVRDQRRI-MHRKVKPNPAIFIQNSFTQVKLSAENANLWIENSHVGEGWKLGSRQI 374 
60682086   268 GEFYHYGTS---KELISSTLSVQNKVYDQRRI-MHRKVKPNPAMFVQNAVVRIPLCAENADLWIENSHIGPKWKIASRHI 343 
53713878   268 GEFYHYGTS---KELISSTLSVQNKVYDQRRI-MHRKVKPNPAMFVQNAVVRIPLCAENADLWIENSHIGPKWKIASRHI 343 
150004170  266 GEFYHYGTS---RELISSTLAVQNLVNDQREI-MHKKVKPHPAMFVQNAEVGYQLTSQNSEIWIENSYVGAGWNIHHQTI 341 
294672915  284 GEFYHFGTS---REMISSTLRIQNLVNDQREI-MHHDRKPHPSLFVQNAVCKYKFTEDNTNIWIENSDVSEGWTLSHDNI 359 
116619704  344 GDFTHIGTTalfRELMTGEAAFREIYTVQQQLgVTRQSGVRSAGVVIDSVLSGGADLGAGTVVIE-CHLESHVRAASGSV 422 
150008207  293 GEFYHYGTS---RELISSTLAVQNLVRDQRAI-MQRKVKPHPAMFVQNAVLHQKLTAENSELWIENSYIGENWTLRGQQI 368 
29347538   375 ITGVPENHWNINLPDGVCIDIVPM----GDAAFVARPYGLDDVFKGDLSNDSTTYLGNSFTQWMKEREIG----LEDIKG 446 
60682086   344 ITGVPENDWSLAVPAGVCVDVVPM----GDKGFVARPYGLDDVFKGDLRDSKTTLTGIPFGEWMSKRGLS----YTDLKG 415 
53713878   344 ITGVPENDWSLAVPAGVCVDVVPM----GDKGFVARPYGLDDVFKGDLRDSKTTLTGIPFGEWMSKRGLS----YTDLKG 415 
150004170  342 ITGVPANNWNLEVPSGVCIDVVPF----GESGYVARPYGFNDTFKGALAKEETYYQGMSVGEWCAVRGIS-----VEEIE 412 
294672915  360 ITGVPQNHWKVNLAPGECIDVVPI----GDTEYAVRLYHIDDKFAGAEQQKQQ--------------------------- 408 
116619704  423 LHGLDAISGTLDIPEDTVIHQLPVelpsGQRGVVIRAYGVEDDAKMSVARGKATWFGRPMLAELEALGLApevvWPDLPR 502 
150008207  369 ITGVPENNWNLSLPEGICVDVVPV----GETNWAARPYGFNDLFKGALSDVSTLFMGKPILTWAMERGIT--------LG 436 
29347538   447 RTDDLQAAPVFPVTTSIEELGILIRWMTAEPQLKEGKELWLRAEKLSADEISAQANLERLYAQRSAFRRDNWKGLSANYE 526 
60682086   416 RTDDLQAVSVFPMVNSVEELGLVLRWMLSEPELEEGKNIWLRSEHFSADEISAGANLKRLYAQREEFRKGNWKALAVNHE 495 
53713878   416 RTDDLQAASVFPMVNSVEELGLVLRWMLSEPELEEGKNIWLRSERFSADEISAGANLKRLYAQREEFRKGNWQALAVNHE 495 
150004170  413 NGHDLQAARLFPVCSSVEELGAVMRWMVSEPALQQGKEIWQRCRKLSADDISAYSNLYRLAEQREAFRIKNWPALAHNYE 492 
294672915  409 ----------FPVVADLEALS-----MLQTLDGLA----LVTSRMISAEEISTEANLHRLFDQRKAFRKLNWSALAKNWN 469 
116619704  503 EEWTLWNAHLFPV-TTVDQAWACARWMLRLPSGYSAAE-WSRHELLSLGAGAQYADGAALEAARSRRLKATWRVLA---- 576 
150008207  437 GNEDIQNAPLFPVCQTVDELGKVLRWMITELDREEGKHIWLSARKLSANDLSDQANLRRLVAQREVFRKKDWSLLAANHE 516 
29347538   527 KSVFYQLDLQDAANEFVRLNLDVPAVLK-EDAAPMVRIHNRMLRARILKLQGNEgCK---------------GEEQAAFQ 590 
60682086   496 KSVFYQLDLADAAEDFVRLGLDMPELLP-EDALQMSRIHNRMLRARILKLDGKD-YR---------------PEEQAAFD 558 
53713878   496 KSVFYQLDLADAAEDFVRLGLDMPELLP-EDALQMSRIHNRMLRARILKLDGKD-YR---------------PEEQAAFD 558 
150004170  493 RSVFYQLNLENAAGEFARYDLSLPEPLS-ESAPLMTRISDNMFRARVQQLKGLA-YR---------------EYENEAFR 555 
294672915  470 HSVFYQLDLADAKREFDEQHIEMPPALD-ADAPLMTRIHDAMFR----------------------------GESEKAFA 520 
116619704  577 ------LTLVDSGADIRPLLANAPGIAAlSETGGALNLRAREMETRAPTESAARyYAaslflgqaglvdeagESRSAAFR 650 
150008207  517 KSVFYQLDLSDAAESFAKDKIVLPKALP-EDNPLMKRIHNHMFRSQVMKISGVA-YK---------------EEEQKAFA 579 
29347538   591 LLRDGLLEAVAGKKNYPKLNVYSDQIVWGRSPVRIDVAGGWTDTPPYSLYSGGSVVNLAIELNGQPPLQVYVKPCHEFHI 670 
60682086   559 LLRDGLLDGISNRKSTPKLDVYSDQIVWGRSPVRIDMAGGWTDTPPYSLYSGGNVVNLAIELNGQPPLQVYVKPCKDFHI 638 
53713878   559 LLRDGLLDGISNRKSTPKLDVYSDQIVWGRSPVRIDMAGGWTDTPPYSLYSGGNVVNLAIELNGQPPLQVYVKPCKDFHI 638 
150004170  556 LMRDGLTASALAKRQQPHLSVYSDQIVWGRSPVRIDLAGGWTDTPPYCLNEGGNVVNIAIELNGQPPLQVYVKPCREYKI 635 
294672915  521 LLREGLLD-TNDYQQIPQLSVADDQIVWGRSPVRIDIAGGWTDTPPYCLMEGGNVINLAIELNGQPPLQTYVRPCQEPRI 599 
116619704  651 LVEQAVQSGAYPRHQTASREWRLKQVTV-EGPARIDLGGGWSDTPPFCLDWGGTVLNIAVLLGGAHPIRTTIRRISEPVV 729 
150008207  580 LLREGLVGSVLGSKQQPCLNVYRDQIVWGRSPVRIDLAGGWTDTPPYCLYAGGNVVNVAIELNGQPPLQVYIKPSDTHKI 659 
29347538   671 VLRSIDMGAVEVIRSYEELQDYKKVGSPFSIPKAALTLAGFAPLFAAESHASLEEHLKAFGSGLEITLLAAIPAGSGLGT 750 
60682086   639 VLRSIDMGAMEIVSTFDELQDYKKIGSPFSIPKAALSLAGFAPAFSAVSYASLEEQLKDFGAGIEVTLLAAIPAGSGLGT 718 
53713878   639 VLRSIDMGAMEIVSTFDELQDYKKIGSPFSIPKAALSLAGFAPAFSAVSYASLEEQLKDFGAGIEVTLLAAIPAGSGLGT 718 
150004170  636 ILRSIDLGAMEVVTTYGEVRDFMQVGSPFSIPKAALVLAGFQPGFSTESYVSLEEQLKAFGSGMEITLLSAIPAGSGLGT 715 
294672915  600 VLRSIDLGAMEVVETSEQLRDFMHVGSPFSIPKAALVLAGFGQR-------SLKDELAAFGAGIELTLLSAIPAGSGLGT 672 
116619704  730 RCVSDEEGLEAEYRNNEELLHPPCPGDPFSIPRTALCMTGLFSR-----EGSLTSVVERLGGGIEIRSGVALPMGSGLGT 804 
150008207  660 ILRSIDLGAMEVISSWDELRDYNKVGSPFSIPKAALALAGFVPEFSAEAYASLDVQLEAFGSGLEITLLAAIPAGSGLGT 739 
29347538   751 SSILASTVLGAINDFCGLAWDRNDICNYTLVLEQLLTTGGGWQDQYGGVFPGVKLLQSESGFEQHPLVRWLPDQLFVQPE 830 
60682086   719 SSILASTVLGAINDFCGLAWDKNEICQRTLVLEQLLTTGGGWQDQYGGVLQGVKLLQTEAGFAQSPLVRWLPDHLFTHPE 798 
53713878   719 SSILASTVLGAINDFCGLAWDKNEICQRTLVLEQLLTTGGGWQDQYGGVLQGVKLLQTEAGFAQSPLVRWLPDHLFTHPE 798 
150004170  716 SSILASTVLGAISDFCGLNWDKNEICNRTLILEQLLTTGGGWQDQYGGVLRGVKLLQTHAGMDQSPLVRWLPDYLFTGGE 795 
294672915  673 SSILAATVLGALNDFCGLGWDKNEIGHRTLMLEQMLTTGGGWQDQFGGVLGGVKLLQTGRGFAQNPQVRWLPTDLWTQPE 752 
116619704  805 SSILAATILRGLSEMLGVELNDQALSEQVMSLEQRMTTGGGWQDQAGGIFPGAKLAVTGPGLQQRIRVQPLLWSLERQQD 884 
150008207  740 SSILAATVLGAISDFCGLAWDKNEIGNRTLILEQLLTTGGGWQDQYGGVLHGLKLLQTNEGFNQNPLVRWLPEYLFTDPE 819 
29347538   831 YRDCHLLYYTGITRTAKGILAEIVSSMFLNSGKHLSLLAEMKAHAMDMSEAILRGNFETFGNLVGKSWIQNQALDSGTNP 910 
60682086   799 YKDCHLLYYTGITRTAKGILAEIVSSMFLNSSLHLNLLSEMKAHALDMNEAIQRGSFVEFGRLVGKTWEQNKALDSGTNP 878 
53713878   799 YKDCHLLYYTGITRTAKGILAEIVSSMFLNSSLHLNLLLEMKAHALDMNEAIQRGSFVEFGRLVGKTWEQNKALDSGTNP 878 
150004170  796 YQKCHLLYYTGITRTAKGILAEIVRSMFLNSTEHLSILGGMKGHALDLYEAIQRGNFDEMGRLVGKSWKLNQALDPGTNP 875 
294672915  753 YRPCHLLYYTGITRTAKSILAEIVRRMFLNHGGELRLLRQMKQHTLDMYEAIQQNDFERMGLLVRKTWAQNQALDAGTNP 832 
116619704  885 FEQRVVLYYTGIQRVARDLLRQVVGRYLARETACVQVLHSIKTLAMEMAYAIQEGEWEHLGALLNRHWELNKTLDPNTAN 964 
150008207  820 YRPCHLLYYTGITRTAKDILSEIVRGMFLNSEVHLGLLSEMKAHALDMYEAIQCGDFVAYGKLVGKTWEQNKALDSGTNP 899 
29347538   911 PAVAAIIEQIKDYTLGYKLPGAGGGGYLYMVAKDPQAAGCIRRILTEQAPNPRARFVEMTLSDKGLQVSRS 981 
60682086   879 PAVEAIIDLIKDYTLGYKLPGAGGGGYLYMVAKDPQAAVRIRKILTENAPNPRARFVEMTLSDKGFQVSRS 949 
53713878   879 PAVEAIIDLIKDYTLGYKLPGAGGGGYLYMVAKDPQAAVRIRKILTENAPNPRARFVEMTLSDKGFQVSRS 949 
150004170  876 EAVETIIRRIDDYCLGYKLPGAGGGGYLYMVAKDPEAAIRIRSILTQNPPNSCARFVDMALSDKGLQISRS 946 
294672915  833 ADVAKLTSLIDDLCLGYKLPGAGGGGYLYMIAKDPEAAARIKQILSENSIRKNARFVDMALSTTGLQISRS 903 
116619704  965 APINSLLETARPFIHGAKLAGAGGGGFLMMVARDPGAAEELKTLLRTQDPQGGSVH-DWSIAREGMRVSKM 1034
150008207  900 AAVEAIISKIQAYALGYKLPGAGGGGYLYIVAKDPGAALQIRKILTLSPPNSNARFVEMSLSNKGLQISRS 970 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap