Conserved Protein Domain Family
PRK13392

?
PRK13392: PRK13392 
5-aminolevulinate synthase; Provisional
Statistics
?
PSSM-Id: 184023
View PSSM: PRK13392
Aligned: 6 rows
Threshold Bit Score: 753.226
Threshold Setting Gi: 304320580
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146340550   1 MKNYDRYFDHALDQLHQERRYRVFADLERRAGRFPHAIWHSPEGPRDVVIWCSNDYLGMGQHPKVIGAMVDVAARMGTGA 80
gi 148255410   1 MMNYDSYFDRALDQLHQERRYRVFADLERLAGRFPRAIWHAPDGPKDVVIWCSNDYLGMGQHPKVIGAMVDVAARMGTGA 80
gi 91976775    3 MYNYRDFFTSELAQLHQEGRYRVFADLEREAHSGIRAFDHRAG--RRITIWCSNDYLSMGVHPEVIAAARVALDQYGAGA 80
gi 83592482    3 LFNYQDFFTNELTQLHREGRYRVFADLERETRSGIHALDHRTG--KRVTIWCSNDYLSMGVHPDVITAALGALEHYGAGA 80
gi 110680925   1 -MDYGSYFAKTLSGLKEEGNYRVFAELERERGAFPRARSHGGETEKPVTIWCSNDYLGMGQHPDVLGAMHDALDRCGAGA 79
gi 304320580   1 -MKFSAHFDAALAQLRRENRYRTFADLERLVGRFPVARYHGPDGVREVVVWCSNDYLGMGQAPFVLEAMTEAASRTGVGA 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146340550  81 GGTRNIAGTNHPLVELERELADLHGKEAALVFTSGYVSNETGISTIAKLLSNCLLLSDALNHNSMIEGVRKAGTEKQVWR 160
gi 148255410  81 GGTRNIAGTNHPLIELERELADLHGKQAALVFTSGYVSNETGISTIAKLLPNCLLLSDALNHNSMIEGVRKAGTEKQVWR 160
gi 91976775   81 GGTRNISGTSHEHVLLERELADLHGKQSALLFTSGYVANDAALSSLGRLLPGCVIFSDALNHASMIEGIRRSGAEKRVFA 160
gi 83592482   81 GGTRNISGTSHEHVLLERELADLHGKQSALLFTSGYVANDAALSSLGRLLPGCVIFSDALNHASMIEGIRRSGAEKRVFA 160
gi 110680925  80 GGTRNISGTTHDHVLLEAELADLHGKESALLFTSGYVSNWAALGTLAGKIPNCLVLSDALNHASMIEGIRHSKAERQIWK 159
gi 304320580  80 GGTRNISGTSHPLVTLEKELADLHGKEAAIVFTSGFVSNDATLSTLGKLLPGCVMISDEMNHASMIEGIRRSGCEKKIFR 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146340550 161 HNDLAHLEELLQAADPDRPKLIVCESLYSMDGDVAPLHRICDLADRYGALTYVDEVHAVGMYGPRGGGIAERDGAMARID 240
gi 148255410 161 HNDIAHLEELLRAADPDRPKLIVCESLYSMDGDVAPLHRICDLAERYGALTYVDEVHAVGMYGPRGGGIAERDGAMARID 240
gi 91976775  161 HNDWRDLERQLASVCTSRPKLICFESCYSMDGDFAPMAAICDLAEEHNAFTYVDEVHAVGLYGARGAGIAERDGLLDRID 240
gi 83592482  161 HNDWHDLERQLASVDPHRPKLICFESCYSMDGDFAPMEAICDLAEKHTAFTYVDEVHAVGLYGARGAGIAERDGLLDRID 240
gi 110680925 160 HNDLADLETKLAQQPLDRPKLIAFESVYSMDGDIAPIADICDLADKYNAMTYLDEVHAVGLYGPRGGGIAEREGLMDRLT 239
gi 304320580 160 HNDTAHLEEILQRLPHDQPKVIAFESVYSMDGDIAPIETICDLADRYNALTYIDEVHAVGMYGAHGGGITDREGLADRID 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146340550 241 ILEGTLAKAFGCLGGYIAANANLIDAVRSYAPGFIFTTALPPPVCAAATAAIRHLKTSQWERDRHQDRAARLKAVLNASG 320
gi 148255410 241 ILEGTLAKAFGCLGGYIAANANLIDAVRSYAPGFIFTTALPPPVCAAATAAIRHLKTSQWERDRHQDRAARLKAVLNAAG 320
gi 91976775  241 MFQGTLSKGFGSIGGYIAGSRDAVDFVRSFAPGFIFSTALPPSVVAGIRAALRHLKEDGSSRLMLAMRTASLKAKMLAND 320
gi 83592482  241 MFQGTLSKGFGAMGGYIAGSLEAVDFVRGFAPGFIFSSALPPCVVAGIRAALHHLKEDDTPRRALARRTASLKAKMQANA 320
gi 110680925 240 VIQGTLGKAFGVVGGYIAASADLCDFVRSFASGFIFTTALPPAVAAGAAASVRHLKTSQAERNAHQDRVAAVRARLDALG 319
gi 304320580 240 LIEGTLAKAFGTLGGYVASSKSVIDAIRSFAPGFIFTTALPPAIAAAATASIRHLKTSATERHLHQERVAATKSAIEDVG 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146340550 321 LPVMPSDTHIVPVHVGDPEKCKSASDLLLAEHGIYIQPINYPTVPRGLERLRITPSPYHDDGLIDALAEALVDVWDRLGL 400
gi 148255410 321 LPVMPSDTHIVPVHVGDPEKCKTASDLLLSEHGIYIQPINYPTVPRGLERLRITPSPYHDDGLIDALAEALVDVWDRLGL 400
gi 91976775  321 IPVLPSPSHILPVMIGDATLAKAITDQLMAEFGIYIQPVNYPTVPRGTERLRITPTPLHTDEDENALVAALVAI--RRQS 398
gi 83592482  321 IPALPSPSHIVPVMIGDAALAKAITDRLMVEHGIYIQPINYPTVPRGTERLRITPTPLHTDEDEDTLVAALVAI--RQEF 398
gi 110680925 320 IPHEMNPSHIIPVMVGCPVKCKYISDILMRDFGVYIQPINYPTVPKGTERLRITPSPVHSAADIDHLVSALGQLWTQCEL 399
gi 304320580 320 LVVMPSQTHIVPLFVGDPTLCKAAADRLLSVHGIYIQPINYPTVPRGTERLRITPTPLHDEHYIAALAGALSETWDALDI 399
                        410
                 ....*....|
gi 146340550 401 PRAAQAMAAE 410
gi 148255410 401 ARAPQALAAE 410
gi 91976775  399 SRWRELAQAA 408
gi 83592482  399 PRWRELAQAA 408
gi 110680925 400 ARLPMAAQ-- 407
gi 304320580 400 PRRRVAGEET 409
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap