Conserved Protein Domain Family
PRK13359

?
PRK13359: PRK13359 
beta-ketoadipyl CoA thiolase; Provisional
Statistics
?
PSSM-Id: 183998
View PSSM: PRK13359
Aligned: 36 rows
Threshold Bit Score: 693.056
Threshold Setting Gi: 295689159
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
152997107   1 MTDALIIDAIRTPIGRYGGALSKVRADDLGAIPIKSLMERNPTVDWSKVDDVLYGCANQAGEDNRNVARMSSLLSGLPHS 80 
295689159   8 IAAAYICDGVRTPFGRYGGALAKVRADDLAAVPLKALARRNTGLDLSAVDEVVLGCANQAGEDNRNVARMALLLAGYPVS 87 
16126646    1 MTAAYICDGIRTPIGRYGGSLSKVRADDLAAIPLKALVARNPSLDLAAIDEIVLGSANQAGEDNRNVARMALLLAGYPVS 80 
221235426   1 MTAAYICDGIRTPIGRYGGSLSKVRADDLAAIPLKALVARNPSLDLAAIDEIVLGSANQAGEDNRNVARMALLLAGYPVS 80 
167033620   6 LADALIIDAVRTPIGRYAGALSSVRTDDLAAVPLKALIQRHPELDWKAVDDVILGCANQAGEDNRNVAHMASLLAGLPLE 85 
26989998    6 HADALIIDAVRTPIGRYAGALSSVRADDLAAIPLKALIQRHPELDWKAIDDVIFGCANQAGEDNRNVAHMASLLAGLPLE 85 
148547696   6 HADALIIDAVRTPIGRYAGALSSVRADDLAAIPLKALIQRHPELDWKAIDDVIFGCANQAGEDNRNVAHMASLLAGLPLE 85 
170721802   6 FEQALIIDAVRTPIGRYGGALSSVRADDLAAVPIRALMARHPELDWAAIDDVILGCANQAGEDNRNVARMASLLAGLPDV 85 
50084860    1 MKHAYIVDAIRTPFGRYAGGLAAVRADDLGAIPIAALIERNPSVNWAQVDDVIYGCANQAGEDNRNVGRMSALLAGLPVE 80 
119896601   1 MTEVFICDGIRTPIGRYGGALSGVRTDDLAALPIKALIARNSGVDWAAVDDIYYGCANQAGEDNRDVARMAGLLAGLPID 80 
152997107  81 VPGTTINRLCGSGMDAVGLAARSIRAGEAGLMIAGGVESMSRAPFVLGKAEQAFSRQADMYDTTIGWRFVNKLMADQFGV 160
295689159  88 VPGVTVNRLCASGLEAVGYAARAIGSGTADLIVAGGVESMSRAPFVMGKADSAFSRNAEIFDTTIGWRFVNAAMRKLYGV 167
16126646   81 VPGVTVNRLCASGLEAVGYAARAIASGHNDLVIAGGVESMSRAPFVMGKADSAFSRSAEIFDTTIGWRFVNPAMRKLYGV 160
221235426  81 VPGVTVNRLCASGLEAVGYAARAIASGHNDLVIAGGVESMSRAPFVMGKADSAFSRSAEIFDTTIGWRFVNPAMRKLYGV 160
167033620  86 VPGTTINRLCGSGLDAIGNAARALRCGEAGLMLAGGVESMSRAPFVMGKSEQAFGRTAELFDTTIGWRFVNPRMKAAYGT 165
26989998   86 VPGTTINRLCGSGLDAIGNAARALRCGEAGLMLAGGVESMSRAPFVMGKSEQAFGRAAELFDTTIGWRFVNPLMKAAYGI 165
148547696  86 VPGTTINRLCGSGLDAIGNAARALRCGEAGLMLAGGVESMSRAPFVMGKSEQPFGRAAELFDTTIGWRFVNPLMKAAYGI 165
170721802  86 VPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESMSRAPFVMGKSEQAFGRSAELFDTTIGWRFVNKLMQAQYGI 165
50084860   81 VPATTVNRLCGSSLDAIAMAARAIKAGEAHLIIAGGVESMSRAPYVMGKSEGAFGRTQKIEDTTMGWRFINPKLKAMYGV 160
119896601  81 VPGSTINRLCGSGMDAVGTAARAIRTGETQLMIAGGVESMSRAPFVMGKADTAFSRSAKIEDTTIGWRFVNPLMKAKYGI 160
152997107 161 HSMPETAENVAEDFKVSRADQDAFALRSQQKTAVAQESGRLSKEIVPVVIPQRKGdPIVVQHDEHPRAdTTLEVLSNLAT 240
295689159 168 DSMPETAENVASDYGVNREDQDAFALRSQQKAAAAIASGFFDGEIVAVEVPGKAG-PTIVNRDEHPRE-TTIDALAKLKP 245
16126646  161 DSMPETAENVATDYGVNREDQDAFALRSQARTAAAQANGFLAGEITPVEIPGKAG-PTIVDRDEHPRE-TTMEALAKLKP 238
221235426 161 DSMPETAENVATDYGVNREDQDAFALRSQARTAAAQANGFLAGEITPVEIPGKAG-PTIVDRDEHPRE-TTMEALAKLKP 238
167033620 166 DSMPETAENVAEQFGISRADQDVFALRSQHKAAAAQARGRLAREIVPVEIAQRKGpAKVVEHDEHPRGdTTLEQLAKLGT 245
26989998  166 DSMPETAENVAEQFGISRADQDAFALRSQHKAAAAQARGRLAREIVPVEIPQRKGpAKVVEHDEHPRGdTTLEQLARLGT 245
148547696 166 DSMPETAENVAEQFGISRADQDAFALRSQHKAAAAQARGRLAREIVPVEIPQRKGpAKVVEHDEHPRGdTTLEQLARLGT 245
170721802 166 DSMPETAENVAAQFGISREAQDAFALRSQQKAAAAQARGRLAREIVPVEIPQRKGpAKLVEHDEHPRAdTTLDQLTRLGT 245
50084860  161 DTMPQTAENVAEQFGIQREDQDQFAYTSQQRTAAAQAKGYFAKEIVPVTIPQRKGePVVIDTDEHPRAsTTLEGLAKLKG 240
119896601 161 DSMPETAENVATDFNINRADQDAFALRSQLRYAAAAERGFYEGELVPVEIAQKKGdPLRVTADEHPRV-TTLEALAKLKG 239
152997107 241 PFRRDgkGTVTAGNASGVNDGACALLLASEEAAKTYGLKARGRVLGMAAAGVEPRIMGIGPAPASQKVLQQVGLTLEDMD 320
295689159 246 VVREG--GTITAGNASGVNDGSVGLLIASEAAVRKHGLSPRARVTGYATAGVEPRVMGVGPVPAVRKLLARTGQSIRDFD 323
16126646  239 IVREG--GTVTAGNASGVNDGAVALVIASEDAVKRHGLTPRARITGYASAGVEPRVMGIGPVPAVRKLMAKTGLAIGDFD 316
221235426 239 IVREG--GTVTAGNASGVNDGAVALVIASEDAVKRHGLTPRARITGYASAGVEPRVMGIGPVPAVRKLMAKTGLAIGDFD 316
167033620 246 PFREG--GSVTAGNASGVNDGACALLLASSDAARLHGLKARGRILGMAVAGVEPRLMGIGPVPATRKVLEMTGLSLADLD 323
26989998  246 PFREG--GSVTAGNASGVNDGACALLLASSAAARRHGLKARGRIVGMAVAGVEPRLMGIGPVPATRKVLALTGLALADLD 323
148547696 246 PFREG--GSVTAGNASGVNDGACALLLASSAAARRHGLKARGRIVGMAVAGVEPRLMGIGPVPATRKVLALTGLALADLD 323
170721802 246 PFREG--GSVTAGNASGVNDGACALLLASTNAARRHGLKPRGRVLGMAAAGVEPRIMGIGPVPATRKVLAQAGLSLADMD 323
50084860  241 VVKPE--GSVTAGNASGINDGAAAVLIASDEAVAQYQLKARAKIIASTTVGIEPRIMGFAPAPAIKKLLKQANLTLDQMD 318
119896601 240 VVRPD--GTVTAGNASGVNDGSVALLLASEAAAAKHGLKPRARIVAMATAGVEPRIMGIGPAPASRKLLALTGLSLDQMD 317
152997107 321 VIELNEAFASQGLAVLRELGLADGDVRVNPNGGAIALGHPLGMSGARLITTALNELEVQQKRYALCTMCIGVGQGIAMVI 400
295689159 324 VVELNEAFAAQCLAVLRQLSLTDDDERVNPNGGAIALGHPLGASGARLVLTALRQLEATGGKRGLATLCIGVGQGAALSF 403
16126646  317 VVELNEAFAAQGLAVLRQLGLPDDGAHVNANGGAIALGHPLGASGARLVLTALRQLEASGGQRGLATLCIGVGQGAALAF 396
221235426 317 VVELNEAFAAQGLAVLRQLGLPDDGAHVNANGGAIALGHPLGASGARLVLTALRQLEASGGQRGLATLCIGVGQGAALAF 396
167033620 324 VIELNEAFAAQGLAVLRELGLTDDDARVNRNGGAIALGHPLGMSGARLVTTALHELEETGGRYALCTMCIGVGQGIAMVI 403
26989998  324 VIELNEAFAAQGLAVLRELGLADDDPRVNRNGGAIALGHPLGMSGARLVTTALHELEETAGRYALCTMCIGVGQGIAMII 403
148547696 324 VIELNEAFAAQGLAVLRELGLADDDPRVNRNGGAIALGHPLGMSGARLVTTALHELEETAGRYALCTMCIGVGQGIAMII 403
170721802 324 VIELNEAFAAQGLAVLRELGLADDDKRVNPNGGAIALGHPLGMSGARLVTTALHELEERGGRYALCTMCIGVGQGIALVI 403
50084860  319 VIELNEAFAAQALACTRDLGLADDDARVNPNGGAIALGHPLGASGARLVTTALNQLEQSGGKYALCSMCIGVGQGIALII 398
119896601 318 VIELNEAFAAQALAVTRQLGLADDDARVNPNGGAISLGHPLGASGARLVLTALRQLEATGGRYGLCTMCIGVGQGIAMII 397
152997107 401 ERL 403
295689159 404 ERV 406
16126646  397 ERV 399
221235426 397 ERV 399
167033620 404 ERL 406
26989998  404 ERL 406
148547696 404 ERL 406
170721802 404 ERL 406
50084860  399 ERV 401
119896601 398 ERV 400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap