Conserved Protein Domain Family
PRK13351

?
PRK13351: PRK13351 
elongation factor G; Reviewed
Links
?
Statistics
?
PSSM-Id: 237358
View PSSM: PRK13351
Aligned: 45 rows
Threshold Bit Score: 633.527
Threshold Setting Gi: 189911443
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119383507   3 REYPLERYRNFGIMAHIDAGKTTTTERILFYTGKNHKMGETHEGASTMDWMEQEAERGITITSAATTTFWQrhedadftp 82
gi 24213436    1 -----MQILNVGIFAHIDAGKTTLLERILYETGKIRRPGTIEEGTTESDYLQEEIERGISIQSTLARVFWPnek------ 69
gi 45658706    1 -----MQILNVGIFAHIDAGKTTLLERILYETGKIRRPGTIEEGTTESDYLQEEIERGISIQSTLARVFWPnek------ 69
gi 189911443   1 ----MKYYRTVGIFAHIDSGKTTLTERILYESGKISAVGSIEDGNTESDSLQEEIERGISIRTTFHSLPWQtd------- 69
gi 116327261   1 -----MQILNVGIFAHIDAGKTTLLERILFESGKIRKPGTIEDGTTESDYLQEEIERGISIQSALARVFWPnak------ 69
gi 116327221   1 -----MQILNVGIFAHIDAGKTTLLERILFESGKIRKPGTIEDGTTESDYLQEEIERGISIQSALARVFWPnak------ 69
gi 116332125   1 -----MQILNVGIFAHIDAGKTTLLERILFESGKIRKPGTIEDGTTESDYLQEEIERGISIQSALARVFWPnak------ 69
gi 16331722    2 NNPTNESLRNVAIVGPYGSGKTTLLESVLWVSGSVSRKGNIKDGNTVSDSSPEAKARQMSVEVSVAGIDYE--------- 72
gi 113476366   2 SEKVASNVRNIAIVGPYLSGKTTLLESLLSITKAISRKGSVKDGNTIGDGSPEARDRSMTVEINAASTKYD--------- 72
gi 116695847   1 MHDSPDAIRTVALLGHAGCGKTSLVEALLHKGGALHTPGSVERGSTVCDSDPLERKYKRSLTTAAAHLHYR--------- 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119383507  83 ddseRCRFNIIDTPGHVDFTIEVERSLAVLDGAICLLDGNAGVEPQTETVWRQADRYKVPRIVFVNKMDKI-------GA 155
gi 24213436   70 --esRMLFQFLDNPGHLDFQSQTSASLIVADLGIVLIDAFEGLKSQTLQNVEWLRKRKIPILFFLNKLDRT-------GI 140
gi 45658706   70 --esRMLFQFLDNPGHLDFQSQTSASLIVADLGIVLIDAFEGLKSQTLQNVEWLRKRKIPILFFLNKLDRT-------GI 140
gi 189911443  70 --fgTFQIQLVDTPGHIDFRNQVTDLLPAMETAVVVLEAGTVVQSQARLVIEELRKASVPIVFFINKLDRF-------GD 140
gi 116327261  70 --kpKVLFQFLDNPGHLDFQSQTSASLIVADLGIVLIDAFEGLKSQTLQNVEWLRKRKIPILFFLNKLDRK-------GI 140
gi 116327221  70 --kpKVLFQFLDNPGHLDFQSQTSASLIVADLGIVLIDAFEGLKSQTLQNVEWLRKRKIPILFFLNKLDRK-------GI 140
gi 116332125  70 --kpKVLFQFLDNPGHLDFQSQTSASLIVADLGIVLIDAFEGLKSQTLQNVEWLRKRKIPILFFLNKLDRK-------GI 140
gi 16331722   73 ----NLRLNFLDCPGSIEFAQETYGALVGAGTAVIVCEADVSRVLTLAPLFKFLDDWAIPHLVFINKMDRA-------KQ 141
gi 113476366  73 ----GINFTFLDCPGSIEFAQETNNALIGAGAAIVVCEPDPARVLTLAPLLKFLDDWEIPHIVFINKMDRVcrdethcKS 148
gi 116695847  72 ----DTRIYLLDTPGYPDFSGLAISALAAVETAAIVINAQTGIEMTTRRAMAWAQARQLCRMIIVNGIDGD-------KV 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119383507 156 DFFKCVAMIKDRTGGTPCPIALPIGAEDKLEGIVDLIKMEEWVWKGEDLGASWVRQPIRDELQDVAEEWRGKMIELAVEQ 235
gi 24213436  141 DITDSLVDLEAVLGKEPILL-----------------------WKEGETCSLLKEGSSDQELL------------PLLEW 185
gi 45658706  141 DITDSLVDLEAVLGKEPILL-----------------------WKEGETCSLLKEGSSDQELL------------PLLEW 185
gi 189911443 141 EYLDTLVSLEEILGVAPVCLFQKTESGA------------------------------LEYYLNHSHSFAKKVDEELLSW 190
gi 116327261 141 DITDSLVDLEAVLGKEPILI-----------------------WKEGEGCSLLQERSSDQELL------------SLLEW 185
gi 116327221 141 DITDSLVDLEAVLGKEPILI-----------------------WKEGEGCSLLQERSSDQELL------------SLLEW 185
gi 116332125 141 DITDSLVDLEAVLGKEPILI-----------------------WKEGEGCSLLQERSSDQELL------------SLLEW 185
gi 16331722  142 PFGEVLQALKSVSSRPLIPQQYPIYKGEELQGYIDLITEQAYQYHTGSAADPI---ALPAELAGAEHQARQEMLEALADF 218
gi 113476366 149 NFGEVLEALKTVSNRPIVPHQYPIAKNNQLIGFIDLVTEQAYHYHPGAPSDPV---TIPESLKVEEQAAREQMLEELANF 225
gi 116695847 141 DLPALLADIQEAFGKECLPINLPAGNGSQ---VVDCFFNPA-----------------GESDFLSVPAAHDALIDQVIEI 200
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119383507 236 DDEAMEAYLD-GNEPDEATLRKLIRKGTLSLSFFPVMAGSAFKNKGVQPLLNAVVDFLPA------PTDVPAYLGFA--- 305
gi 24213436  186 DEKLSERYLK-HPDSLSELAREGFAEGFWKNQFFPVFGGAALHGDGVRELLAVLELLSKTfrpelrPKEE---------- 254
gi 45658706  186 DEKLSERYLK-HPDSLSELAREGFAEGFWKNQFFPVFGGAALHGDGVRELLAVLELLSKTfrpelrPKEE---------- 254
gi 189911443 191 NDELLISSWS-QSSSSADFARIGLKDGPKSGKLFPVYGGSAKTGEGVRELLDLLLWTNPKvptdiiPLAYPLLVLSRrma 269
gi 116327261 186 DPKLSERYLK-HPESLAELAREGFAEGFWKEEFFPVLGGAALHGDGVRELL-VILELLSM------SYRPEPRPGEE--- 254
gi 116327221 186 DPKLSERYLK-HPESLAELAREGFAEGFWKEEFFPVLGGAALHGDGVRELL-VILELLSM------SYRPEPRPGEE--- 254
gi 116332125 186 DPKLSERYLK-HPESLAELAREGFAEGFWKEEFFPVLGGAALHGDGVRELL-VILELLSM------SYRPEPRPGEE--- 254
gi 16331722  219 DDRLLEELLE-EVEPPQAEIEADFKQELGADLIVPVVLGAAEQDFGVRPLLDVLIKEAPD------PSVTAARRS----- 286
gi 113476366 226 DDNLLEELVE-NIEPPTEEIVADIKMELSADLIVPVFVGVAEKDSGVRSLLDALVRETPV------PKETAKRRGLK--- 295
gi 116695847 201 DPELMELYLEqGEAITPEQLHAPFERALREGHLVPICFTSAATGAGITELLDVFVQLLPN------PTEGNPPLFYRdtg 274
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119383507 306 ------PGDETETrnieRSASDDQPFSALAFKIMNDPFv-GSLTFTRIYSGQLKKGDQMLNATKGKRERVGRMMVMHAIN 378
gi 24213436  255 --------------------------LGIVFKRELHPDl-GKIVYIQPMQ-EFPQNSHFYSAAGKA--QFGSFYQLSMRE 304
gi 45658706  255 --------------------------LGIVFKRELHPDl-GKIVYIQPMQ-EFPQNSHFYSAAGKA--QFGSFYQLSMRE 304
gi 189911443 270 egigpyAVVYPLKdlseLDLLSMTETFLQSVPLPPNASnaGLFQFIDPETEETT-----------QEIHKGKLVLLKHNE 338
gi 116327261 255 --------------------------LGIVFKRELHPDl-GKIVYI-LATKEFRQNSPFYADTGEG--RIGPCYFLSTRD 304
gi 116327221 255 --------------------------LGIVFKRELHPDl-GKIVYI-LATKEFRQNSPFYADTGEG--RIGPCYFLSTRD 304
gi 116332125 255 --------------------------LGIVFKRELHPDl-GKIVYI-LATKEFRQNSPFYADTGEG--RIGPCYFLSTRD 304
gi 16331722  287 -----------------LSTDGSGPVIAQVLKTYFTPQ--GRLSLARIWQGTLREADSL------NGQRLGGIYRLFGNQ 341
gi 113476366 296 --------------------SNSETPIAQVLKTYYTPQg-GKLSLVRVWQGEIIDGMIL------NGVRIGGIYRLMGQQ 348
gi 116695847 275 ---dgsEHRKAVR----AEPVPDKHVLAHVFKVVIDPYv-GKLAVFRIHQGTVTRDSQLYIGDGRQPFKVAHLLRLQGKE 346
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119383507 379 REEIEEAFAGEIIALAGLKETTTGDTLCDPAKPVVLET--MTFPEPVIEIAVEPKSKADQEKMGLALQRLAAEDPSFRVE 456
gi 24213436  305 FEETSRTQPREIVVTTGLEFLKPGEILYSTPQNNYKSE--LLPVRKQFQIILEPEVAEHRDSLWNSLQTLVWLDEGLETK 382
gi 45658706  305 FEETSRTQPREIVVTTGLEFLKPGEILYSTPQNNYKSE--LLPVRKQFQIILEPEVAEHRDSLWNSLQTLVWLDEGLETK 382
gi 189911443 339 RFLLYPGEPVALRNVQGIGNENQKD---------------QRSPSP-FSLVIEPEESSDKEFWLCRLEELVWEDPGYQTA 402
gi 116327261 305 FEETFQAEPREIIVGTGLEFLKSGDILYSSPQTFYQSK--LPSVRKQFQILLEPEADKHRDSLWSALQTLVWLDEGLEAK 382
gi 116327221 305 FEETFQAEPREIIVGTGLEFLKSGDILYSSPQTFYQSK--LPSVRKQFQILLEPEADKHRDSLWSALQTLVWLDEGLEAK 382
gi 116332125 305 FEETFQAEPREIIVGTGLEFLKSGDILYSSPQTFYQSK--LPSVRKQFQILLEPEADKHRDSLWSALQTLVWLDEGLEAK 382
gi 16331722  342 QTPVQTATVGEIVGLARLENINTGTTLSTADVKPLPF---VEPLPPVYGLAIAPEQRKDEVKLSTALGKLVEEDPSLTWE 418
gi 113476366 349 TESLELAKTGEIVALSRMEGIHTGDTLTIDADGKTKLPrvILLP-PVFAMAIAPENRKDEVKMSSALTKLLEEDPALIWE 427
gi 116695847 347 TQEIPRAGPGDICAVAKVDELGFDAVLHDATEDGNIHLtpLEFPTPIYGLAIEPARRGNEQRLAEVLHKLSAEDPCLRVE 426
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119383507 457 TDMESGQTIMKGMGELHLDILVDRMKREFKVEANIGAPQVAYRETISQPAEIDYTHKKQTGGTGQFARVKLQIEPTEPGE 536
gi 24213436  383 ILSETGQIQLSGLGELHLEVSLSRLKEFFPNTFNVSSIKVARFELWKKMARQGEFQHTAFDQKISSGLVHASLVSSN--- 459
gi 45658706  383 ILSETGQIQLSGLGELHLEVSLSRLKEFFPNTFNVSSIKVARFELWKKMARQGEFQHTAFDQKISSGLVHASLVSSN--- 459
gi 189911443 403 IKEDTGQIVLFGRGELHLEIGIKRISGKTEKKLTFSSINIAKLELFKKMSHKVALEHRAFEDQKSSGTLIAVLEDTA--- 479
gi 116327261 383 ILLDTGQIQISGLGELHLEVSLSRLREFFPHRFNVSSIKVARFELWKKMARQGEFQHTAFDQKISSGLVHASLVSSN--- 459
gi 116327221 383 ILLDTGQIQISGLGELHLEVSLSRLREFFPHRFNVSSIKVARFELWKKMARQGEFQHTAFDQKISSGLVHASLVSSN--- 459
gi 116332125 383 ILLDTGQIQISGLGELHLEVSLSRLREFFPHRFNVSSIKVARFELWKKMARQGEFQHTAFDQKISSGLVHASLVSSN--- 459
gi 16331722  419 QNTETQEVILWGQGEIHLKVALERLERQYKLPMVSQQPQVPYKETIRKGTEVHGRYKHQTGGHGAFGDVYLTIKPLERGN 498
gi 113476366 428 QHGDTHEVIFWGQGEIHLQVSLERLHRKYNVSMKTYLPRVPYKETIRKKTTSHGRYKHQSGGHGQFGDVYLDIQPLPRGS 507
gi 116695847 427 HPVGTNETVVFGLGEFHLRCALERLTEQYKLEVVTRPPKIAYRETIGGKAEGHHRHKKQTGGAGQFGEVMLRVEPLARGE 506
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119383507 537 GYSFESKIVGGaVPKEYIPGVEKGIKSVMDSGPLAGFPVIDFKVALIDGAFHDVDSS--VLAFEIAARAGMREGLKKAGA 614
gi 24213436  460 -SFAREVRFETkITETLKEAITSAFYEVVVKGT-KGEEILGLDLIVHRYDPPDISID--VSSLVKVAVIKGLKDIIPGNT 535
gi 45658706  460 -SFAREVRFETkITETLKEAITSAFYEVVVKGT-KGEEILGLDLIVHRYDPPDISID--VSSLVKVAVIKGLKDIIPGNT 535
gi 189911443 480 -DFSKQIAFEVsLPEEVKNSIEMSFKEACLHGF-YGEEVCGLRLRILSYEMPKGDLQttLTLLKVAILAGVKECFP-SNT 556
gi 116327261 460 -SFSRDVRFETkITETLEEAITSAFYEVVAKGS-KGEEILGLDLIVHRYDPPDTLTTdvSSLVKVAVIKGLKDIIPKYT- 536
gi 116327221 460 -SFSRDVRFETkITETLEEAITSAFYEVVAKGS-KGEEILGLDLIVHRYDPPDTLTTdvSSLVKVAVIKGLKDIIPKYT- 536
gi 116332125 460 -SFSRDVRFETkITETLEEAITSAFYEVVAKGS-KGEEILGLDLIVHRYDPPDTLTTdvSSLVKVAVIKGLKDIIPKYT- 536
gi 16331722  499 GFSFSETIVGGvVPKQYIPGVEMGVREYLAKGP-LGYPVVDIAVTLTDGSYHNVDSS--EQAFKQAARLAMTEGMPQCNP 575
gi 113476366 508 GFNFSETVVGGvVPKQYISGVETGVREYLQQGP-LGFPVVDVAVTLTNGSHHSVDSS--EQAFKQAARVAMQQGMSDCQP 584
gi 116695847 507 GFDFVDAVKGGaIPGQFIPAVEKGIRQVLDSGPLAGFPMQDVRVTVYDGKSHPVDSK--EVAFATAGRKAFIDAVLKARP 584
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119383507 615 KLLEPIMRVEVVTPEEYTGSIIGDLTSRRGMVRGQDTRGNANV---IDAFVPLANMFGYINNLRSMSSGRAVFTMQFDHY 691
gi 24213436  536 ELVGPISHLEILISDSSLGDVLGSLSKRSAKIQEVNPIGDGKSl--VRASASTENLLGFAGVLRNMTQGRGVLSLD-SLF 612
gi 45658706  536 ELVGPISHLEILISDSSLGDVLGSLSKRSAKIQEVNPIGDGKSl--VRASASTENLLGFAGVLRNMTQGRGVLSLD-SLF 612
gi 189911443 557 YLVGPLTEIEVMVDSDHLGVVLSDLSRRDAKVVSIIEAVAGKSh--LKANAPAQNLLGFSGALRNMTKGIG-ISWERTAF 633
gi 116327261 537 ELVGPVSTVEILIPDVSLGDVLGSLSKRNAKIQEVVPLGDGKSl--VHAKASTENLLGFAGVLRNMTQGRGVLSLD-SLF 613
gi 116327221 537 ELVGPVSTVEILIPDVSLGDVLGSLSKRNAKIQEVVPLGDGKSl--VHAKASTENLLGFAGVLRNMTQGRGVLSLD-SLF 613
gi 116332125 537 ELVGPVSTVEILIPDVSLGDVLGSLSKRNAKIQEVVPLGDGKSl--VHAKASTENLLGFAGVLRNMTQGRGVLSLD-SLF 613
gi 16331722  576 VLLEPILSVNVTTPTEFTSRVLQLVSGHRGQILGYEARSDWKSwdqVAAHLPQAEMQNFIIELRSLTLGVGNFTWQSDHL 655
gi 113476366 585 VLLEPIALVDIFAPNEFTSKVLQLISIRRGQILGYESMTDWERwdkTSAYLALSEMQDLIVELRSQTMGVGSFNWQFDHL 664
gi 116695847 585 SVLEPIVDIEVTAPGTAMGDIIGDLSTKRGQVHGTRTAVGNAVv--VAGQVPLSELNDYQSRLNSITGGHGSYTIQFSHY 662
                        730
                 ....*....|....
gi 119383507 692 EAVPQNISDEIQKK 705
gi 24213436  613 DPEHYYVIT----- 621
gi 45658706  613 DPEHYYVIT----- 621
gi 189911443 634 TSEFYAVLKE---- 643
gi 116327261 614 NPEHYYVITLVDSR 627
gi 116327221 614 NPEHYYVITLVDSR 627
gi 116332125 614 NPEHYYVITLVDSR 627
gi 16331722  656 QEVPDKFAPNLRPD 669
gi 113476366 665 QEVPNKLAEKVLIK 678
gi 116695847 663 DNVPPAQQDKMASK 676
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap