Conserved Protein Domain Family
ureC

?
PRK13308: ureC 
urease subunit alpha; Reviewed
Statistics
?
PSSM-Id: 183965
View PSSM: PRK13308
Aligned: 21 rows
Threshold Bit Score: 1003.84
Threshold Setting Gi: 118472448
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300024315   1 MAVLSRRDYAAMYGPTVGDGVRLGDTSLVAVIEKDFASYGDECLHGGGKTLRDGAGLAAGVTSTEGALDFLLCNVTVIDA 80
gi 146340995   1 MATLTRQAYAELYGPTKGDLVRLADTSLLAEIEHDYTTYGHELLVGAGKNIRDGEAVAAHRTSTHKVLDVVVKNATIVDA 80
gi 148255799   1 MATLTRRAYAELYGPTKGDLVRLADTSLLAEIEHDYTTYGHELLVGAGKNLRDGEAVAAHRTSQHKALDVVVKNATIVDA 80
gi 254562770   2 VQSLPRRHYLELYGPTLGDRVRLGDTALWAQVEADLTHYGDELVFGAGKTMRVGTGCDGALTAADGILDLVITNALIIDA 81
gi 145222277   2 GHRISRSHYAELYGPTTGDRVRLADTELLAKVEHDATVYGDESVFGGGKTMREGMAVHGDITNADGALDFVITNVLIIDA 81
gi 55376690    2 TRDIDRENYAELYGPTTGDKVRLGDTELFAKVEEDLRTHGDEAVFGGGKTLRDGLGMAPGVTQAEGALDWVLTNATIIDP 81
gi 292654327   2 TKDIDREAYADLYGPSEGDRVRLADTELFAEVETDLRTHGDEAVFGGGKTLRDGLGMAPDVTQADGALDWVITNATVIDP 81
gi 76801650    2 TKTLPREEYTDLFGATVGDRIRLGDTSLLAEIEHDHATYGDEAVFGGGKTMRDGMGMQSGTTQADGALDWVFSNVVVVDP 81
gi 284164838   2 SRNLSREEYTELFGATEGDRLRLGDTNLFAEIETDYGVPGEEAVFGGGKTMRDGMGMQSGTTQAEGTLDWAFTNVVIIDP 81
gi 110669477   2 SRKLSREAYTDLFGATEGDRLRLGDTNLLAKIEKDHGTYGDEAVFGGGKTMRDGMGMQSGTTQAEGALDWVFSNAVIIDP 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300024315  81 VVGIVKGDLGIKDGKIVGIGKAGNPAIMDGVDPRLIVSAATAVRDCEGLIATAGGIDVHVHFDSAQLCDHAIASGITTLL 160
gi 146340995  81 VIGIVKADIGIRDGRIVGIGKAGNPDIMPDVHPDMVVGHTTAPIAGGPFIVTAGAIESHAHLISPEQSDHALAGGTTTMV 160
gi 148255799  81 VIGIVKADIGIRDGRIVGIGKAGNSDVMPDVHPDMVVGHTTAPIAGGPFIVTAGAIESHAHLISPEQSDHALSGGTTTMI 160
gi 254562770  82 VAGVIKADIGIKDGRIVGIGKAGDPRIMDGVSPDLIVGVNTDVRAAEGLIVTAGGIDCHVHFIDPGQCQEALSAGVTTLM 161
gi 145222277  82 VLGIRKADIGIRDGRIAGIGKSGNPRTMDGVDPDLVIGAGTDIRAGEGMIATAGGIDVHVHFDSAGLVEEAISSGITTMI 161
gi 55376690   82 ILGIVAADIGIRNGEIAGIGKAGNPDTMDGVD--MVVGPSTDVYPAEGKIATAGGLDIHIHFNSAQLHEHALSGGITTML 159
gi 292654327  82 VLGVVAGDIGIRDGDIVGVGKAGNPDTMDGVD--MVVGPATDVYPAEGKIATAGALDIHVHWNSAQLHEHGLASGITTML 159
gi 76801650   82 VLGIRKGDIGVRNGRIVGVGKAGNPDTMDGVDDELVVGPSTDTVPADGLIATPGGLDIHVHFNSPQLVDHALASGITTMF 161
gi 284164838  82 VLGICKGDIGVRDGKIVGVGKAGNPDTMDGVD--MVIGPSTDTIPADGLIATPGALDIHVHFNSPQLVDHALGSGVTTML 159
gi 110669477  82 ILGIQKGDIGVRDGKIAGIGKAGNPDTMDGVDDELVIGPSTDTAPADGLIATPGGLDIHIHFNSKELFEHALASGVTTMF 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300024315 161 GGSLGPiTVGIDCGGAFNVGKMLQAAEQWPVNFGFLGRGNSHKPASLVEQIEAGCLGLKLHEDWGSMPSAIDTCLALADD 240
gi 146340995 161 GNGSGP-VFDVGSGSGPNFGHFLKSIEFSPLNYALFGRGGSD-PAAVEEAVAAGGMSVKIHEDFGASPDVIDKTLIAADR 238
gi 148255799 161 GNGSGP-VFDVGSGSGPNFGHFLKSIEFSPLNYALFGRGGSN-PEAVEEAVAAGGMSVKIHEDFGAAPDVIDKTLIAADR 238
gi 254562770 162 GGGLGPtTVPIASTGTVNLGLMLQASEAFPLNFGFFGKAASDTAAPLLEQLAAGAAGLKIHEDWGATTAAIGSALEAADR 241
gi 145222277 162 GGGLGPvTVGITTSGPNNLARMLRAAEGFPMNFGFIANGSASSTAPLIEQGLAGAIGYKIHEDWGATPAAIRASLDAGDE 241
gi 55376690  160 GGGYGG-GATTCTTGPENVKRFLQAAEAWPVNVGFYGKGNASDPGPLREQVEAGVCGLKLHEDWGSTPETINTCLEVAED 238
gi 292654327 160 GGGYGG-GATTCTTGPQNIKRFLQAAEAWPVNVGFYGKGNASTPEPLIEQVEAGACALKLHEDWGSMPAAIDTCLDVAED 238
gi 76801650  162 GGGYGG-GATTCTPGPNNVKRFLQAADEWPVNVGFYGKGNSSQPEGLAEQVEAGACGMKLHEDWGSTPAAIDTCLEYAES 240
gi 284164838 160 GGGFGG-GATTCTPGPRNIQRFLQAAEEWPVNVGFYAKGNSSRPEALVEQIEAGACGMKLHEDWGSTPAAIDTCLEVADE 238
gi 110669477 162 GGGYGG-GATTCTTGPENIKRFLQAAEEYPVNVGFYAKGNSSGPDPIIEQIEAGACGLKLHEDWGSTPDVIDTALTVADE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300024315 241 MDFPVQIHTDTLNESGFVEDTLAAIAERTIHMYHTEGAGGGHAPDIIRVAGLPWCLPSSTNPTNPYTINTFDEHLDMTMV 320
gi 146340995 239 NDFAVHLHTDSINEYGFCEDTMAAVDGRTIHMYHVEGAGGGHAPDLLKVVSWPNVIPSSTNPTNPYTSYGMEEGVPMTMI 318
gi 148255799 239 HDFAVHLHTDSINEYGFCEDTMAAVDGRTIHMYHVEGAGGGHAPDLLKVVSWPNVIPSSTNPTNPYTSYGMEEGVPMTMI 318
gi 254562770 242 GHAQIQLHTDTLNEFGFLEDSLEAIAGRTIHAYHVEGAGGGHAPDIIRVCSHPNVLPSSTNPTNPFTVNTFDEHFDMAMT 321
gi 145222277 242 LDLQVQIHTDTLNESGFFEDTMRAIGGRPIHTYHAEGAGGGHAPDIMRVVGEPYCLPSSTNPTNPYTLNTFDEHLDMVMV 321
gi 55376690  239 EDVQVCMHTDTLNEAGFLENTFGAVDGRTMHLFHIEGAGGGHAPDIMEMVGEPNMLPSSTNPSMPYTDNTFDEHLDMVMV 318
gi 292654327 239 EDVQVCMHTDTLNEAGFVENTFAAVDGRTMHLFHIEGAGGGHAPDIMELVGEPNMLPSSTNPSMPYTDNTFDEHLDMVMV 318
gi 76801650  241 ADIQVCIHTDTLNESGFVEETFDAIDGRAIHTFHIEGAGGGHAPDVLELVGHEHMLPSSTNPSMPYTENTFDEHLDMVMV 320
gi 284164838 239 EDVQVCIHTDTLNESGFVEHTFDAIDGRAIHTFHIEGAGGGHAPDVLELIGHEHMLPSSTNPSMPYTENTFDEHLDMVMV 318
gi 110669477 241 EDVQVCIHTDTLNESGFLEDTFEAIDGRTIHTFHIEGAGGGHAPDVLELIGYDHMLPSSTNPSMPYTVNTFDEHLDMVMV 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300024315 321 CHHLNPAIPEDVAFAESRIRAQTIAAEDILHDIGAISMLGSDSQGMGRINEVICRTWQLADKMKSQRGRLPEESTPFGDN 400
gi 146340995 319 CHQLNYNAPEDVMFGEARVRAQSMAAEDFLHDMGAISIFGTDTQGMGRLAENVAKCWQLASVMKDRIGRLPEETTARADN 398
gi 148255799 319 CHQLNYNAPEDVMFGEARVRAQSMAAEDFLHDMGAISIFGTDTQGMGRLAENVAKCWQLASVMKDRTGRLPEETTARADN 398
gi 254562770 322 SHHLNPRVAEDVAFAESRIRKETIGAEDILHDIGAISALGSDSQGMGRIGETIARTWQLASIMRQTRGPLPEDMGSGNDN 401
gi 145222277 322 CHHLSPRIPEDVAFAESRIRRETIAAEDVLHDLGAISAMGSDSQGMGRIGETIARTWQLASHMRATRGPLPGDEGTGADN 401
gi 55376690  319 CHHLNPDVPEDVAFAESRVRAETIAAEDVLHDMGAISMMTSDSQAMGRIAEVIPRTWQTASKMKSQRGPLPEDEGTGADN 398
gi 292654327 319 CHHLNPDVPEDVAFAESRVRAETIAAEDVLHDMGAISMMTTDSQAMGRQAELVSRTWQAASKMKSQRGPLPEDEGTGADN 398
gi 76801650  321 CHHLNPDVPEDVAFAESRIRAETIAAEDVLHDTGAISMMTSDSQAMGRMAEVISRTWQTADKMKQQRGPLPEDDGTDADN 400
gi 284164838 319 CHHLDPDIPEDVAFAESRIRAETIGAEDVLHDTGAISMMTTDSQAMGRMAELISRTWQTAHKMKAQRGPLSADEGTDADN 398
gi 110669477 321 CHHLNPDVPEDVAFAESRIRSETIAAEDVLHDMGAISMMTSDSQAMGRMAEVITRTWQTAHKMKSQRGALPADRGTDADN 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300024315 401 ERIKRYVAKYTINPARTFGIADHIGSLEDGKLADIVVWSPAFFGIKPELILKGGFIAWGAMGDSSASLMTCEPRALRPQW 480
gi 146340995 399 ERIKRYVAKLTINPAIAVGINHVVGSIEVGKMADLVLWPRASFGLKPYMVIKNGFPVWAAMGDGNGSLGLSEPMIQKRMW 478
gi 148255799 399 ERIKRYIAKLTINPAIAVGIDHVVGSIEVGKMADLVLWPRASFGLKPYMVIKNGFPVWAAMGDGNGSLGLSEPMIQKRMW 478
gi 254562770 402 LRIKRYIAKYTINPAKIFGIDHEIGSIERGKLADLVFWKPALFGVKPELVLKSGFPAWAVTGEANASLMVCEPLLYRPQW 481
gi 145222277 402 ARILRYVAKLTINPARLFGIDHEVGSLEPGKLADIVLWEPKFFGIRPEVVFKGGFPAWSVMGEANASLMTCEPLRYRPQW 481
gi 55376690  399 HRIKRYIAKYTVNPAISAGIEEHVGTLEPGKLADICLWDPAFFGVKPAMTFKGGFPVHSEMGEANGSLMTCEPILQRERA 478
gi 292654327 399 HRIKRYLAKYTINPAISAGIDDYVGTLEPGKLADVVLWDPAFFGVKPAMIFKGGFPVHSEMGEANGSLMTCEPILQRQRA 478
gi 76801650  401 HRIKRYVAKYTINPAIVAGIDDYVGSIEPGKLADIVLWEPAFFGIKPKTVIKGGFPVYSQMGEANGSLMTCEPVEMRPRA 480
gi 284164838 399 ARIERYVAKYTINPAITAGIDDYVGSLEPGKLADIALWDPAFFGVKPKAVIKGGFPVWSQMGEANGSLMTCEPVIGRERA 478
gi 110669477 401 ARIKRYVAKYTINPAKVAGINEYVGSLEPGKMADIVLWEPEFYGIKPKYVIKGGFPVHSEMGEANGSLMTCEPVMQRSRM 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 300024315 481 GAFGRASPALSACFVNPAAIDRGISKTLDLKKNLLPARGTRRLSKKDMLRNDACPD-IRVDPQTFDVFVDGELATCEPAH 559
gi 146340995 479 GALGAAPQRLGVNFMSKLAVDARIRDKLGLGRETVQIKNVRRLRKTDMIRNAAMPQ-VEVDPQTFEVRADGKLLMCPPAT 557
gi 148255799 479 GALGAAPQRLGVNFMSKLAVDADIRGRLGLGRATVQIKNVRRLRKTDMIRNAAMPH-VEVDPQTFEVRADGKLLMCPPAT 557
gi 254562770 482 GSFGRAARSLSVRFISPLALEADLPRRLGLESRCVATRSTRGLTKHDMVLNDALPD-IAVDADTYRVSIDGEACLSAPVG 560
gi 145222277 482 AAFGRAPADVSVNFVAGAAIDAGLGQQLGLDTRLVACRGARALTKADLLHNDHLPD-IRIEPDTYRVTVDGQPCVSTPMT 560
gi 55376690  479 GAVGKAKHAISLSFVSPAAAEAGIDEEYGLDSRVVPIEGARTPGKDDMVYNSYCPDdIEVDPETFEVRVDGEHVTCEPSS 558
gi 292654327 479 GADGKAKHGLSLSFVSPAAADNDVGEAYGLDSRVVPVGGTRTPGKEDMLYNDYCPDdIDVDPETFEVEVDGELVTCEPAS 558
gi 76801650  481 GAMGNAKHGLSVTFVSGTAHEAGVGDAYGLDTPVRPVDGTRSVRKADMLYNDYCPDdIDIDAQTFEVSIDGEHVTCEPAD 560
gi 284164838 479 GAQGRAKHGLSVTFVSEAAYENEVGDAYDLKTPVRPVTGTREVCKSDMVHNDHCPDdIEIDAQTFEVEVDGEHVTCDPAD 558
gi 110669477 481 GAVGKAKHAISTTFVSKAAYENDIGDQIGLESRVRPVEGTRDVGKNDMRHNEYAPEnIDIDPQTFEVAVDGEHVTCEPAE 560
                        570
                 ....*....|.
gi 300024315 560 ELPLSQRYMLR 570
gi 146340995 558 TVPLARRFMLR 568
gi 148255799 558 TVPLARRFMLR 568
gi 254562770 561 TVPLGSLYMMK 571
gi 145222277 561 EVPLGRRYTLK 571
gi 55376690  559 ELPLAQRYLL- 568
gi 292654327 559 ELPLAQRYTL- 568
gi 76801650  561 ELPLAQRYHL- 570
gi 284164838 559 EIPLAQRYLL- 568
gi 110669477 561 ELPLAKRYSL- 570
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap