Conserved Protein Domain Family
PRK13301

?
PRK13301: PRK13301 
putative L-aspartate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 106261
View PSSM: PRK13301
Aligned: 3 rows
Threshold Bit Score: 437.616
Threshold Setting Gi: 33592964
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33600732   1 MTHRIAFIGLGAIASDVAAGLLADAAQPCQLAALTRNAADLPPALAGRVALLDGLPGLLAWRPDLVVEAAGQQAIAEHAE 80 
33596898   1 MTHRIAFIGLGAIASDVAAGLLADAAQPCQLAALTRNAADLPPALAGRVALLDGLPGLLAWRPDLVVEAAGQQAIAEHAE 80 
33592964   1 MTHRIAFIGLGAIASDVAAGLLADAAQPCQLAALTRNAADLPPALAGRVALLDGLPGLLAWRPDLVVEAAGQQAIAEHAE 80 
33600732  81 GCLRAGLDMIICSAGALADDALRARLIAAAEAGGARIRVPAGAIAGLDYLQAVAGRDDAEVVYESRKPVAAWRAELPGMG 160
33596898  81 GCLKAGLDMIICSAGALADDALRARLIAAAEAGGARIRVPAGAIAGLDYLQAVAGRDDAEVVYESRKPVAAWRAELPGMG 160
33592964  81 GCLTAGLDMIICSAGALADDALRARLIAAAEAGGARIRVPAGAIAGLDYLQAVAGRDDAEVVYESRKPVAAWRAELPGMG 160
33600732 161 IDPDTLAESRTLFSGPAREAALRFPKNLNVAATLALAGIGMTRTRVEVVVDPRARGNQHRIQVRSPLGEMQIELVNAPSP 240
33596898 161 IDPDTLAESRTLFSGPAREAALRFPKNLNVAATLALAGIGMTRTRVEVVVDPRARGNQHRIQVRSPLGEMQIELVNAPSP 240
33592964 161 IDPDTLAESRTLFSGPAREAALRFPKNLNVAATLALAGIGMTRTRVEVVVDPQARGNQHRIQVRSPLGEMQIELVNAPSP 240
33600732 241 ANPKTSWLVAQSVLATIRRHLARFTIG 267
33596898 241 ANPKTSWLVAQSVLATIRRHLARFTIG 267
33592964 241 ANPKTSWLVAHSVLATIRRHLARFTIG 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap