Conserved Protein Domain Family
PRK13188

?
PRK13188: PRK13188 
bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
Links
?
Statistics
?
PSSM-Id: 237296
Aligned: 43 rows
Threshold Bit Score: -1
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189346101   1 MLIHQRTLQQEVSLQGSGLHTGKECIITFKPAPVNYGYRFIRTDLEDQPEIPALIENVVDVLRGTTIAVNDVKIHTTEHV 80 
189499519   1 MLIHQRTLDKEVSLQGTGLHTGKKCMITFKPAPVNYGYRFVRTDIENCPEIPALIDYVVDVCRGTTIEFEGNKVHTTEHV 80 
194335782   1 MLILQRTLQKEVSLWGSGLHTGKECMITFKPAPVNYGYRFVRTDIDDSPEIPALIENVVDVLRGTTIGLNGVKVHTTEHV 80 
194333342   1 MLIHQRTLKNEVSLWGRGLHTGKECMITFKPAPDNYGYRFIRTDVEDCPEIPALIDNVVDVCRGTTIECNGVKVHTTEHV 80 
193215648   1 MLIYQRTLKKEVSLWGTGLHTGKDCMITFKPAPEGYGYRFVRTDLPDSPEIPADIDHVVDIRRGTTIGIGDAKIHTTEHV 80 
226226994   1 MGGERRTIAGVASVQGIGLHLGQPCTLTFRPAPACHGIVFRRMDLPGTPTIPARIDVAVQAERRTQLGTGEAALHTVEHV 80 
182414392   1 --MKQRTLAREVSIKGSALHTGDPVTLTMKPAPVDHGIVFKRTDLHGSPELRPRVDQVTDLVRATTIQSGHAKIHTVEHV 78 
193212197   1 MLINQRTIQGDVSLTGTGLHTGRECTITFKPAPVNTGYIFVRNDIDDCPEIPALIDHVVDVLRGTTIGIGDVKVHTTEHV 80 
21674480    1 MLIHQRTLQNEISLTGIGLHTGHECTITFKPAPVNTGYIFVRTDINDCPEIPALIDHVVDVLRGTTIGIGDVKVHTTEHV 80 
294055142   1 --MKQRTILREVSIKGKSLHTGEEVNLTLKPAPENHGIVFKRVDLYGKPELKPLVDLVEDLVRSTTIADGHAKVHTVEHV 78 
189499519   1 MLIHQRTLDKEVSLQGTGLHTGKKCMITFKPAPVNYGYRFVRTDIENCPEIPALIDYVVDVCRGTTIEFEGNKVHTTEHV 80 
194335782   1 MLILQRTLQKEVSLWGSGLHTGKECMITFKPAPVNYGYRFVRTDIDDSPEIPALIENVVDVLRGTTIGLNGVKVHTTEHV 80 
194333342   1 MLIHQRTLKNEVSLWGRGLHTGKECMITFKPAPDNYGYRFIRTDVEDCPEIPALIDNVVDVCRGTTIECNGVKVHTTEHV 80 
193215648   1 MLIYQRTLKKEVSLWGTGLHTGKDCMITFKPAPEGYGYRFVRTDLPDSPEIPADIDHVVDIRRGTTIGIGDAKIHTTEHV 80 
226226994   1 MGGERRTIAGVASVQGIGLHLGQPCTLTFRPAPACHGIVFRRMDLPGTPTIPARIDVAVQAERRTQLGTGEAALHTVEHV 80 
182414392   1 --MKQRTLAREVSIKGSALHTGDPVTLTMKPAPVDHGIVFKRTDLHGSPELRPRVDQVTDLVRATTIQSGHAKIHTVEHV 78 
193212197   1 MLINQRTIQGDVSLTGTGLHTGRECTITFKPAPVNTGYIFVRNDIDDCPEIPALIDHVVDVLRGTTIGIGDVKVHTTEHV 80 
21674480    1 MLIHQRTLQNEISLTGIGLHTGHECTITFKPAPVNTGYIFVRTDINDCPEIPALIDHVVDVLRGTTIGIGDVKVHTTEHV 80 
294055142   1 --MKQRTILREVSIKGKSLHTGEEVNLTLKPAPENHGIVFKRVDLYGKPELKPLVDLVEDLVRSTTIADGHAKVHTVEHV 78 
189346101  81 LAALYGLQIDNCRIEMSGPEPPVMDGSSLPFAERLLSAGIVEQDEPKNYLVIDETVEYHDTKNSVDIVALPLDSFRVTVM 160
189499519  81 LAALYGLEIDNCRIEMSGPEPPVMDGSSREFAQALKSAGLAEQDEPKNYLVIDETIEYHDAENKVDIVALPLDGFRSTVM 160
194335782  81 LGALYGLQIDNCRIEISGPEPPVMDGSSHPFAAALIEAGFKEQDEPKNYLVIDETIEYHDANNSVDIVALPLDSFRITVM 160
194333342  81 LAALYGLQIDNCRIEMNGPEPPVMDGSSQQFAEALLEAGFHEQEEPKNYLVIDESIEYHDQDNGVDIVGLPLDGFRTTVM 160
193215648  81 LSALYGLEIDNCRIELTGPEPPVCDGSSKPFVDAILSVGLQNQSEPKNYLVINETIEYHEPERNISIVALPLDSFRITVM 160
226226994  81 LAAVGGLAIDDLLIDMDGPEPPIMDGSAKAFLDALTEAGVVTHPGRVDWLVLRKSIRVVDGESVYE--AHPALDYSLDVD 158
182414392  79 LSALHGCGIDNVLLEMDASEPPIMDGSARPFVNLILQAEPVEQDKDREYFELDAPVSVT--RGNSSIIALPSDVLKISC- 155
193212197  81 LAALYGLQIDNCRIELSGPEPPVLDGSAHPFAEAILSAGIAEQDEPKNYLVIDETIEFHNPEKSVDIVALPLDGFRMTVM 160
21674480   81 LAALYGLQIDNCRIELSGPEPPVLDGSSNPFAEALLSAGIAEQDEPKNYLVIDETIEFHNPEKSVDIVALPLDGFRMTVM 160
294055142  79 LSALNGCGVDNVLIEMDASEPPILDGSAKHFVNLIQQAEPVEQKAERVYYELDEPISVT--RGASSIIALPHDGFRITC- 155
189499519  81 LAALYGLEIDNCRIEMSGPEPPVMDGSSREFAQALKSAGLAEQDEPKNYLVIDETIEYHDAENKVDIVALPLDGFRSTVM 160
194335782  81 LGALYGLQIDNCRIEISGPEPPVMDGSSHPFAAALIEAGFKEQDEPKNYLVIDETIEYHDANNSVDIVALPLDSFRITVM 160
194333342  81 LAALYGLQIDNCRIEMNGPEPPVMDGSSQQFAEALLEAGFHEQEEPKNYLVIDESIEYHDQDNGVDIVGLPLDGFRTTVM 160
193215648  81 LSALYGLEIDNCRIELTGPEPPVCDGSSKPFVDAILSVGLQNQSEPKNYLVINETIEYHEPERNISIVALPLDSFRITVM 160
226226994  81 LAAVGGLAIDDLLIDMDGPEPPIMDGSAKAFLDALTEAGVVTHPGRVDWLVLRKSIRVVDGESVYE--AHPALDYSLDVD 158
182414392  79 LSALHGCGIDNVLLEMDASEPPIMDGSARPFVNLILQAEPVEQDKDREYFELDAPVSVT--RGNSSIIALPSDVLKISC- 155
193212197  81 LAALYGLQIDNCRIELSGPEPPVLDGSAHPFAEAILSAGIAEQDEPKNYLVIDETIEFHNPEKSVDIVALPLDGFRMTVM 160
21674480   81 LAALYGLQIDNCRIELSGPEPPVLDGSSNPFAEALLSAGIAEQDEPKNYLVIDETIEFHNPEKSVDIVALPLDGFRMTVM 160
294055142  79 LSALNGCGVDNVLIEMDASEPPILDGSAKHFVNLIQQAEPVEQKAERVYYELDEPISVT--RGASSIIALPHDGFRITC- 155
189346101 161 VDYKNPALGSQHSGLFDLQkEFMQDFAPCRTFCFLSEVEALANQGIIKGGDIDNAVVIVDKTMQKDELEALAEKLGIGSA 240
189499519 161 VDYKNPALGSQHSGIFNLEkEFLNDFAPCRTFCFLSEVEELATIGIIKGGDLDNAVVIVDKEMTDTELDNLAKKIGIDSS 240
194335782 161 VDYKNPALGSQHSGLFDLDkEFVKEFSSSRTFCFLSEVEALANQGIIKGGDVDNAIVIIDKTMCEQELSDLGKKLGIESK 240
194333342 161 VDYKNPALGSQHSGLFDLDnEFLKDFAPCRTFCFLSEVEALANLGIIKGGDIDNAVVIVDKTLSSEELDALAEKIGIDPS 240
193215648 161 VDYKNPALGSQHSGLFNLEkEFVNDFASSRTFCFLSEVSELANQGLIKGGDIENAVVIVDQKMAQHELEALAKKIGEDGS 240
226226994 159 IDFPHPLIGHQAGHYRVTAeGFRRDLADARTFGFLHEVDALRAKGLIQGASTANAVVL---------------------- 216
182414392 156 TSADDRGIHTQHLSLTIDPeVYQTQVAAARTFTIYEDIEELLKLGKIRGGSLDCAVVI---------------------- 213
193212197 161 VDYKNPALGSQHSGLFDLDkEFLREFSPCRTFCFLSEVEAMANQGIIKGADIDNAVVIVDKQLDETEVQTLADKVGVDAS 240
21674480  161 VDYKNPALGSQHSGLFDLDkEFLREFSPCRTFCFLSEVEAMANQGIIKGADIDNAIVIVDKQLDETEVQTLADKVGVDAS 240
294055142 156 TSADDRGIHTQHLMLDVDPeTFISEIAPARTFTIYEDIEELLKLGKIKGGSLDSAIVI---------------------- 213
189499519 161 VDYKNPALGSQHSGIFNLEkEFLNDFAPCRTFCFLSEVEELATIGIIKGGDLDNAVVIVDKEMTDTELDNLAKKIGIDSS 240
194335782 161 VDYKNPALGSQHSGLFDLDkEFVKEFSSSRTFCFLSEVEALANQGIIKGGDVDNAIVIIDKTMCEQELSDLGKKLGIESK 240
194333342 161 VDYKNPALGSQHSGLFDLDnEFLKDFAPCRTFCFLSEVEALANLGIIKGGDIDNAVVIVDKTLSSEELDALAEKIGIDPS 240
193215648 161 VDYKNPALGSQHSGLFNLEkEFVNDFASSRTFCFLSEVSELANQGLIKGGDIENAVVIVDQKMAQHELEALAKKIGEDGS 240
226226994 159 IDFPHPLIGHQAGHYRVTAeGFRRDLADARTFGFLHEVDALRAKGLIQGASTANAVVL---------------------- 216
182414392 156 TSADDRGIHTQHLSLTIDPeVYQTQVAAARTFTIYEDIEELLKLGKIRGGSLDCAVVI---------------------- 213
193212197 161 VDYKNPALGSQHSGLFDLDkEFLREFSPCRTFCFLSEVEAMANQGIIKGADIDNAVVIVDKQLDETEVQTLADKVGVDAS 240
21674480  161 VDYKNPALGSQHSGLFDLDkEFLREFSPCRTFCFLSEVEAMANQGIIKGADIDNAIVIVDKQLDETEVQTLADKVGVDAS 240
294055142 156 TSADDRGIHTQHLMLDVDPeTFISEIAPARTFTIYEDIEELLKLGKIKGGSLDSAIVI---------------------- 213
189346101 241 KlTtGENGILNNRELRFTNEPARHKLLDLLGDIALLGMPIKAQVLAARPGHASNVEFVKQLKKYADRNKL--AR------ 312
189499519 241 RlVlGENGILNNRELRFENEPARHKLLDLIGDIALLGMPVKAQILAARPGHASNVEFVKLLKKYADRNRL--AR------ 312
194335782 241 NlVlGDNGILNNRELRFKNEPARHKLLDLLGDIALLGMPLKAQVLAARPGHASNVEFVKQLKKYVDRNKL--AR------ 312
194333342 241 GlIlGDNGILNNRELRFTNEPARHKLLDLLGDLALLGMPIKAQILAARPGHASNVEFVKLLKKYADRNAL--AR------ 312
193215648 241 QlCiGENGILNNRELRFPNEPARHKLLDMLGDLALLGMPIKAQVLAARPGHAANVEFVKKLRKYAERNKL--AQ------ 312
226226994 217 ----DAAGVVDT-TLRWPDEFVRHKALDCVGDLVLAGARVRARIIAHKPSHRGTVALVRALVQ----------------- 274
182414392 214 ----RGDKIISKEPLRFKDEFVRHKILDIIGDVMLLGLPLKAHIVATRPGHAINAELTKAIYQKLLERKQggTKkkekpv 289
193212197 241 HlVlGQNGILNNRELRFTNEPARHKLLDLLGDLALLGMPVKAQILAARPGHASNVEFVKQLKKYADRNKL--AR------ 312
21674480  241 HlVlGQNGILNNRELRFSNEPARHKLLDLLGDLALLGMPVKAQILAXRPGHASNVEFVKQLKKYADRNKL--AR------ 312
294055142 214 ----KGDKIVSKEPLRFKDEFVRHKMLDIIGDIVLAGMPIKAHIIGVRPGHALNAELSKALRQKIIEKAKpkKK------ 283
189499519 241 RlVlGENGILNNRELRFENEPARHKLLDLIGDIALLGMPVKAQILAARPGHASNVEFVKLLKKYADRNRL--AR------ 312
194335782 241 NlVlGDNGILNNRELRFKNEPARHKLLDLLGDIALLGMPLKAQVLAARPGHASNVEFVKQLKKYVDRNKL--AR------ 312
194333342 241 GlIlGDNGILNNRELRFTNEPARHKLLDLLGDLALLGMPIKAQILAARPGHASNVEFVKLLKKYADRNAL--AR------ 312
193215648 241 QlCiGENGILNNRELRFPNEPARHKLLDMLGDLALLGMPIKAQVLAARPGHAANVEFVKKLRKYAERNKL--AQ------ 312
226226994 217 ----DAAGVVDT-TLRWPDEFVRHKALDCVGDLVLAGARVRARIIAHKPSHRGTVALVRALVQ----------------- 274
182414392 214 ----RGDKIISKEPLRFKDEFVRHKILDIIGDVMLLGLPLKAHIVATRPGHAINAELTKAIYQKLLERKQggTKkkekpv 289
193212197 241 HlVlGQNGILNNRELRFTNEPARHKLLDLLGDLALLGMPVKAQILAARPGHASNVEFVKQLKKYADRNKL--AR------ 312
21674480  241 HlVlGQNGILNNRELRFSNEPARHKLLDLLGDLALLGMPVKAQILAXRPGHASNVEFVKQLKKYADRNKL--AR------ 312
294055142 214 ----KGDKIVSKEPLRFKDEFVRHKMLDIIGDIVLAGMPIKAHIIGVRPGHALNAELSKALRQKIIEKAKpkKK------ 283
189346101 313 QFQ-HEKKAGVVFDINAIQNILPHRYPFLLIDKIVEFKl--DEKIVSIKNVTMNEPFFQGHFPGNPIMPGVLILEAMAQT 389
189499519 313 QFQ-HEKKSGVIFDINAIQKILPHRYPFLLIDKIVEFKl--DDKIVSIKNVTMNEEFFQGHFPGNPIMPGVLIVEAMAQT 389
194335782 313 QFQ-HEKKAGVIFDINAIQQILPHRYPFLLIDKIIEFKl--DEKIVSIKNVTINEPFFQGHFPGNPIMPGVLILEAMAQT 389
194333342 313 QYQ-HEKKAGVIFDINAIQNILPHRYPFLLIDKIVEFKl--DEKIVSIKNVTMNEEFFQGHFPGNPIMPGVLIIEAMAQT 389
193215648 313 KFQ-HERKAGIIFDSQAIARIIPHRYPFLLIDKIVEFEl--DERIVGVKNVTINEPFFQGHFPGNPIMPGVLILEAMAQS 389
226226994 275 ----HAVREPAVYTIEDILQVLPHRYPFLLVDRILELEe--GKRIVGLKNVTINEPFFQGHFPGHPIMPGVLIIEAMAQV 348
182414392 290 APT-MLLTDETSLDIRRILDTVPHRYPFIMVDRVLEIKg--PDELVALKNVTINEPYFQGHFPGNPVMPGVLQIEAMAQA 366
193212197 313 QYQ-HEKKAGVIFDINAIQNILPHRYPFLLIDKIVEFKl--DEKIVSIKNVTMNEPFFQGHFPGNPVMPGVLIIEAMAQT 389
21674480  313 QYQ-HEKKAGVIFDINAIQNILPHRYPFLLIDKIVEFKl--DEKIVSIKNVTMNEPFFQGHFPGNPIMPGVLIIEAMAQT 389
294055142 284 EPVkFVEAHETKLDIRRVLDILPHRYPFVMIDRVCEISgdnEDELVALKNVTINEPYFQGHYPGRPVMPGVLQVEAMAQA 363
189499519 313 QFQ-HEKKSGVIFDINAIQKILPHRYPFLLIDKIVEFKl--DDKIVSIKNVTMNEEFFQGHFPGNPIMPGVLIVEAMAQT 389
194335782 313 QFQ-HEKKAGVIFDINAIQQILPHRYPFLLIDKIIEFKl--DEKIVSIKNVTINEPFFQGHFPGNPIMPGVLILEAMAQT 389
194333342 313 QYQ-HEKKAGVIFDINAIQNILPHRYPFLLIDKIVEFKl--DEKIVSIKNVTMNEEFFQGHFPGNPIMPGVLIIEAMAQT 389
193215648 313 KFQ-HERKAGIIFDSQAIARIIPHRYPFLLIDKIVEFEl--DERIVGVKNVTINEPFFQGHFPGNPIMPGVLILEAMAQS 389
226226994 275 ----HAVREPAVYTIEDILQVLPHRYPFLLVDRILELEe--GKRIVGLKNVTINEPFFQGHFPGHPIMPGVLIIEAMAQV 348
182414392 290 APT-MLLTDETSLDIRRILDTVPHRYPFIMVDRVLEIKg--PDELVALKNVTINEPYFQGHFPGNPVMPGVLQIEAMAQA 366
193212197 313 QYQ-HEKKAGVIFDINAIQNILPHRYPFLLIDKIVEFKl--DEKIVSIKNVTMNEPFFQGHFPGNPVMPGVLIIEAMAQT 389
21674480  313 QYQ-HEKKAGVIFDINAIQNILPHRYPFLLIDKIVEFKl--DEKIVSIKNVTMNEPFFQGHFPGNPIMPGVLIIEAMAQT 389
294055142 284 EPVkFVEAHETKLDIRRVLDILPHRYPFVMIDRVCEISgdnEDELVALKNVTINEPYFQGHYPGRPVMPGVLQVEAMAQA 363
189346101 390 GGIMMLNGNENIKESVVYFMGIDKARFRKPVLPGDTLVIEA-VMTNKRRTVCQFDAKAFVRGELVCEASLMATVVSKN 466
189499519 390 GGIMMLNGNDNIGNMQVYFMGIDKARFRKPVIPGDTLVIEA-VMKSRRRSVCQFDAKAYVRGDLVCEASLMATVVEKK 466
194335782 390 GGIMMLNGNDNIKESVVLFMGIDKARFRKPVLPGDTLVIEA-ILTNKRRNICQFDAKAYVRGELVCEASLMATVAPKS 466
194333342 390 GGIMMLNGNDNINDMQVYFMGIDKARFRKPVVPGDTLVIEA-VMKSRRRSVCQFDGKAYVRGELVCEASLMATVVKKE 466
193215648 390 GGIMLLNGNEGFHDKLVFFMGIDKARFRKPVVPGDTLTIES-IMKNRRRNVCMFSSKAYVRGELVCEAELMATVIDKK 466
226226994 349 GGMLLMRTVTDPSTKVVYFMSLDNVKFRRPVKPGDQLRFEMeVLQ-MRGTMCKMRGVAYVDGQVVTEAEMAAMVRDR- 424
182414392 367 AGILMLRKISS-EGKTALFMSCDKVKFRRAVRPGDQLLIQVkMTKSRGNRIGVAEGQCSVNGQVVSSAELMFTVIDET 443
193212197 390 GGIMMLNGKENIKESVVFFMGIDKARFRKPVLPGDTLVIEA-VMTNMRRTVCQFDAKAYVRGELVCEASLMATVMDKK 466
21674480  390 GGIMMLNGKENIKESVVFFMGIDKARFRKPVLPGDTLVIEA-VMTNMRRTVCQFDAKAYVRGELVCEASLMATVMEKK 466
294055142 364 AGILLLRKIPIEENKIAFFMSADKVKFRQAVEPGDSIELRVkLIKIRGNKLATATGECRVAGKVVSSAELMFMLADAS 441
189499519 390 GGIMMLNGNDNIGNMQVYFMGIDKARFRKPVIPGDTLVIEA-VMKSRRRSVCQFDAKAYVRGDLVCEASLMATVVEKK 466
194335782 390 GGIMMLNGNDNIKESVVLFMGIDKARFRKPVLPGDTLVIEA-ILTNKRRNICQFDAKAYVRGELVCEASLMATVAPKS 466
194333342 390 GGIMMLNGNDNINDMQVYFMGIDKARFRKPVVPGDTLVIEA-VMKSRRRSVCQFDGKAYVRGELVCEASLMATVVKKE 466
193215648 390 GGIMLLNGNEGFHDKLVFFMGIDKARFRKPVVPGDTLTIES-IMKNRRRNVCMFSSKAYVRGELVCEAELMATVIDKK 466
226226994 349 GGMLLMRTVTDPSTKVVYFMSLDNVKFRRPVKPGDQLRFEMeVLQ-MRGTMCKMRGVAYVDGQVVTEAEMAAMVRDR- 424
182414392 367 AGILMLRKISS-EGKTALFMSCDKVKFRRAVRPGDQLLIQVkMTKSRGNRIGVAEGQCSVNGQVVSSAELMFTVIDET 443
193212197 390 GGIMMLNGKENIKESVVFFMGIDKARFRKPVLPGDTLVIEA-VMTNMRRTVCQFDAKAYVRGELVCEASLMATVMDKK 466
21674480  390 GGIMMLNGKENIKESVVFFMGIDKARFRKPVLPGDTLVIEA-VMTNMRRTVCQFDAKAYVRGELVCEASLMATVMEKK 466
294055142 364 AGILLLRKIPIEENKIAFFMSADKVKFRQAVEPGDSIELRVkLIKIRGNKLATATGECRVAGKVVSSAELMFMLADAS 441
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap