Conserved Protein Domain Family
trpA

?
PRK13115: trpA (this model, PSSM-Id:106096 is obsolete)
tryptophan synthase subunit alpha; Provisional
Statistics
?
PSSM-Id: 106096
View PSSM: PRK13115
Aligned: 30 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119025809  15 GISHKPSPTETMFDEFKAADKPAFIGYLPYGFPDPDYSLKAFRTMVEHGVNAVEIGLPYSDPVMDGPVIQAASQIAIDNG 94 
119961937   1 MTEEFASKSAGAIDRAKADGRAALVGYLPAGYPTVQESIEAGIALARNGADLIEIGIPYSDPVMDGPVIQAATTEAISNG 80 
116670250   5 QDITSTSKSAAAIDKARAEGRVALIGYLPAGFPSVEDTIAVGIALAENGADLIEIGIPYSDPVMDGQVIQAATTEALAKG 84 
23465333   16 GISHKPSKSGAMFTKFKAENKPAFIGYLPYGFPNPDVSLDAFKTMVEHGVDAVEIGLPYSDPVMDGPVIQAAASIALNNG 95 
148272944   5 AAPPAVSPVERAIAVRREQGSGALVGYLPVGFPDLATSIEAAVALVENGVDVIELGLPYSDPVMDGPVIQRATQTALAQG 84 
111224356   1 ----MQSRLDERFTAAREEGRSLLVGYLPAGYPTVDGAVAAMRAMVAAGVDVVEVGLPYSDPTMDGPVIQDAADAALRGG 76 
86741701    1 ----MQSRLDAVFAAAREEGRSVLVGYLPAGFPTVDGAIEAMRAMVAAGVDVVEVGLPYSDPTMDGPVIQDAADAALRGG 76 
158313768  34 ARRGGPSPLDEAFAAARKDGRAVLVGYLPAGFPTVDRGIAAMRAMVAAGVDVVEVGLPYSDPTMDGPVIQDAADTALRGG 113
50954796    1 -----MSRVADTIARRKGEAAGALIGYLPAGFPDLRTSVDAAVALAENGVDVIELGLPYSDPVMDGAVIQAATQRALANG 75 
163841071   4 SSEIVPSKSAAAIDRAHAAGRTALIGYLPAGYPDVQSSIDAGIAMSRNGADLIEIGIPYSDPVMDGPVIQAATTEALANG 83 
119025809  95 EKIANVFKAV-ETVANAGGVPLVMSYWNLIFHYGVERFARDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSP 173
119961937  81 FRVSNVFDVVaGITAATDAAVLVMTYWNPVMRMGVDEFSRRLAEAGGAGLITPDLVPDEAHEWFEASDKYGLDRVFLVAP 160
116670250  85 FHVRQVFDVVrGITSKTDAAVLVMTYWNPVVRMGVDEFSRQLAEAGGAGLITPDLIPDEASEWMAASDKYGLDRVFLVAP 164
23465333   96 ETIKRVFEAV-ETVANAGGVPLIMSYWNLVYHYGVERFARDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSP 174
148272944  85 FRLRDGFDALhAITQRVDAPVLLMTYWNPVVQYGVERFADDIVAAGGAGLITPDLIPDEGADWLAASERTGLDRVFLAAP 164
111224356  77 VTTVDVLRTV-EAVAATGAPTVVMTYWNPIDRYGPARFAADLAAAGGAGTITPDLPPEEADPWLAASAEHGLDPVFLVAP 155
86741701   77 VTTRDVIRTV-EAVAATGAPALVMSYWNPIDRYGAASFAADLAAAGGAGAITPDLPPEEAGPWLDACAAHGLAPVFLVAP 155
158313768 114 VTTRDVLRTV-EAVAETGAPTLVMTYWNPVERYGMEAFAADLAAAGGAGAITPDLPPEEAGPWLAASATHGLDPVFLVAP 192
50954796   76 FRLRDGFAAVrEITSRVDAPVLVMTYWNPVMQYGVDRFADDFATAGGAGLITPDLIPDEGADWLAASERTGLDRVFLAAP 155
163841071  84 FRVASVFDVVaGITAVTDVAVLVMTYWNPVVRMGVRDFSRRFAEAGGAGLITPDLVPDEASEWLEASEEFGLDRVFLVAP 163
119025809 174 DSTEDRLKVVADNARGFVYAAARMGVTGERSTIDASPKELVARTRKAGAKNVCVGIGVSTAEQGARVGSYADGVIVGSAL 253
119961937 161 SSTPERLDMTVKASRGFVYAVSIMGVTGTRTSVSSSAQDVVARAHAAGAERVCVGLGVSNPDHVREIAAYADGVIVGTAL 240
116670250 165 SSSPERMKRTVDASRGFVYAVSIMGVTGARTSVSSAAEGVVAAAHAAGAERVCVGLGVSNAGQVREIAAYADGVIVGTAL 244
23465333  175 DSSTERLETVARNARGFVYAAARMGVTGERATIDASPELLVERTRQAGAENVCVGIGVSTAEQGAKVGSYADGVIVGSAL 254
148272944 165 SSSEARLRQGVERSRGFVYAVSTMGITGARQDVDQAARGLVSRLRDAGSTSACVGIGISTGDQVREVLDYADGAIVGSAL 244
111224356 156 SSSDARIRRVTGISRGFVYAASLMGVTGTRAAVGSQAADLVARVRATTELPVAVGLGVSTGAQAAEVAGFADGVIVGSAL 235
86741701  156 SSSDTRLRLVAGVARGFVYAASLMGVTGTRAAVGERAADLVARVRAATELPVAVGLGVSTAAQAAEVAGFADGVIVGSAL 235
158313768 193 SSTTERLRLVTAHSGGFVYAASTMGVTGARAAVGVKAAGLVARVREVTDLPVAVGLGVSTGAQASEVAGFADGVIVGSAL 272
50954796  156 SSTEARRRQTAANSRGFVYAVSTMGITGVRTDVDAAARTLVGRLREAGALSACVGLGISSAAQVAEVLDYADGAIVGSAL 235
163841071 164 SSTPERLASTVAASRGFVYAVSVMGVTGTRANVSTSAQSLVARTRAAGAERVCVGLGVSNANHVKEIGSYADGVIVGTAL 243
119025809 254 VHTMIdESgkhavdeatGLKALAAKTEELAEGIHNARN 291
119961937 241 VAALR-DG---------GVDAVGQLTKNLSAGLGRAAA 268
116670250 245 VAAIR-DG---------GVDAVAALTKDLSTGLTREEA 272
23465333  255 VHTLLaDDnktardpkeGLKLLAAKSEELAEGIHNAR- 291
148272944 245 VAALA-DG---------GVPGVARAAADLARGTALQ-- 270
111224356 236 VKVLV-DAqrsgtgdaaALAGIGRLAAELAEGVRAPVP 272
86741701  236 VKVLL-EAersgagasaGLAGIRRLAAELAGGVRAPVP 272
158313768 273 VRALA-ADard---gadGVGAIERLAAELAAGVRSATA 306
50954796  236 VTALA-KG---------GVAAAGRIAAELARGAVRG-- 261
163841071 244 VAALR-DG---------GVDSVGQLTSELSSGTSRSEA 271
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap