Conserved Protein Domain Family
PRK12880

?
PRK12880: PRK12880 
3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Statistics
?
PSSM-Id: 171793
View PSSM: PRK12880
Aligned: 5 rows
Threshold Bit Score: 639.321
Threshold Setting Gi: 222824300
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57238350    1 MKTRFDKAKISGICVSVPEHKICIDDELESVFSNDIKTLKRMKKVIGLNTRYICDENTCVSDLGKHAANTLLQGLNIDKN 80 
121613632   1 MKTRFDKAKISGICVSVPEHKICIDDELESVFSNDIKTLKRMKKVIGLNTRYICDENTCVSDLGKHAANTLLQGLNIDKN 80 
153951808   1 MKTRFDKAKISGICVSVPEHKICIDDELESVFSNDIKTLKRMKKVIGLNTRYICDENTCVSDLGKHATNTLLQGLNIDKN 80 
218562914   1 MKTRFDKAKISGICVSVPEHKICIDDELESVFSNDIKTLKRMKKVIGLNTRYICDENTCVSDLGKHAANTLLQGLNIDKN 80 
222824300   1 MKAKFNNANIAGISVCVPKTCIKIDDCLKDVFKNDEKLLKRMKKISGLEQRFIADEKTSVVDLAYEASLNLFKMLKFDKN 80 
57238350   81 SLDALIVVTQSPDFFMPSTACYLHQLLNLSSKTVAFDLGQACAGYLYGLFVAHSLIQSGLGK-ILLICGDTLSKFIHPKN 159
121613632  81 SLDALIVVTQSPDFFMPSTACYLHQLLNLSSKTIAFDLGQACAGYLYGLFVAHSLIQSGLGK-ILLICGDTLSKFIHPKN 159
153951808  81 SLDALIVVTQSPDFFMPSTACYLHQLLNLSSKTIAFDLGQACAGYLYGLFVAHSLIQSGLGK-ILLVCGDTLSKFIHPKN 159
218562914  81 SLDALIVVTQSPDFFMPSTACYLHQLLNLSSKTVAFDLGQACAGYLYGLFVAHSLIQSGLGK-ILLICGDTLSKFIHPKN 159
222824300  81 DLDMIIFITQTPDFFMPSCANYLHKRLNLKPNTIAFDVNQACAGYIYGLFFSFNFLENQLAKnILLICGDTLSKTINPQN 160
57238350  160 MNLAPIFGDGVSATLIEKTDFNEAFFELGSDGKYFDKLIIPKGAMRIPKADIFNDDSLMQTEEFRQLENLYMDGANIFNM 239
121613632 160 MNLAPIFGDGVSATLIEKTDFNEAFFELGSDGKYFDKLIIPKGAMRIPKADIFNDDSLMQTEEFRQLENLYMDGANIFNM 239
153951808 160 MNLAPIFGDGVSATLIEKTDFNEAFFDLGSDGRHFDKLIIPKGAMRIPKADIFNDDSLMQTEEFRQLENLYMDGANIFNM 239
218562914 160 MNLAPIFGDGVSATLIEKTDFNEAFFELGSDGKYFDKLIIPKGAMRIPKADIFNDDSLMQTEEFRQLENLYMDGANIFNM 239
222824300 161 PNLAPIFGDGVSATLI-KNEKNTSFFELFSDGKGYDKLIIPNKAFAKLDKNKTNNEEIFKIDEYRNLENLYMDGAEIFNQ 239
57238350  240 ALESEPKSFKEILEFSKVDEKDIAFHLFHQSNAYLVDCIKEELKLNDDKVPNFIMEKYANLSACSLPALLCELDTPKEFK 319
121613632 240 ALECEPKSFKEILEFSKVDEKDIAFHLFHQSNAYLVDCIKEELKLNDDKVPNFIMEKYANLSACSLPALLCELDTPKEFK 319
153951808 240 ALECEPKSFKEILEFSKVEEKDITFHLFHQSNAYLVDCIKEELKLNDDKVPNFIMEKYANLSACSLPALLCELDTPKEFK 319
218562914 240 ALECEPKSFKEILEFSKVDEKDIAFHLFHQSNAYLVDCIKEELKLNDDKVPNFIMEKYANLSACSLPTLLCELDTPKEFK 319
222824300 240 ALNLESQSVKNMLEICGKNEDEIDYFLFHQSNKFLVDSIINELNLNTQKTPNFLMSKYANLSACSIPALLCEMNK-NDFK 318
57238350  320 ASLSAFGAGLSWGSAVLNF-KDLYTKDILIYTKEK 353
121613632 320 ASLSAFGAGLSWGSAVLNF-KDLYTKDILIYTKEK 353
153951808 320 ASLSAFGAGLSWGSAVLNF-KDLYTKDILIYTKEK 353
218562914 320 ASLSAFGAGLSWGSAVLNF-KDLYTKNILIYTKEK 353
222824300 319 AILSAFGAGYAYGSAYINFdKNFKTDTISIYKGEK 353
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap