Conserved Protein Domain Family
PRK12804

?
PRK12804: PRK12804 
flagellin; Provisional
Statistics
?
PSSM-Id: 183759
View PSSM: PRK12804
Aligned: 9 rows
Threshold Bit Score: 451.375
Threshold Setting Gi: 305676139
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52082071    1 MRINHNIAALNTLNRLSANNGASQKNMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLEMASKNAQDGISLIQTAEGAL 80
gi 52787460    1 MRINHNIAALNTLNRLSANNGASQKNMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLEMASKNAQDGISLIQTAEGAL 80
gi 157691933   6 MRINHNIAALNTLNRLSANNGASQKNMEKLSSGLKINRAGDDAAGLAISEKMRGQIRGLEMASKNAQDGISLIQTAEGAL 85
gi 305676139   1 MRINHNIAALNTLNRLGSNNGAAQKNMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLEMASKNSQDGISLIQTAEGAL 80
gi 157691931   1 MRINHNIAALNTLNRLSANNGASQKNMEKLSSGLKINRAGDDAAGLAISEKMRGQIRGLEMASKNAQDGISLIQTAEGAL 80
gi 157691934   1 MRINHNIAALNTLNRLSANNGAGQKNMEKLSSGLKINRAGDDAAGLAISEKMRGQIRGLEMATKNAQDGISLIQTAEGAL 80
gi 16080589    1 MRINHNIAALNTLNRLSSNNSASQKNMEKLSSGLRINRAGDDAAGLAISEKMRGQIRGLEMASKNSQDGISLIQTAEGAL 80
gi 157691932   1 MRINHNIAALNTLNRLSANNGASQKNMEKLSSGLKINRAGDDAAGLAISEKMRGQIRGLEMATKNAQDGISLIQTAEGAL 80
gi 157690947   1 MRINHNIAALNTLNRLSANNGASQKNMEKLSSGLKINRAGDDAAGLAISEKMRGQIRGLEMASKNAQDGISLIQTAEGAL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52082071   81 TETHSILQRVRELVVQAGNTGTQQ-TEDLTAIQDEIKALKDEI------DGISERTEFNGKKLLDGTFKap--------- 144
gi 52787460   81 TETHSILQRVRELVVQAGNTGTQQ-TEDLTAIQDEIKALKDEI------DGISERTEFNGKKLLDGTFKap--------- 144
gi 157691933  86 TETHSILQRVRELVVQAGNTGTQD-GTDLGAIQEEINNLIKEIgggtdgNGISDRTEFNGKKLLNGDFE----------- 153
gi 305676139  81 TETHAILQRMRELTVQAGNTGTQQ-AEDLGAIKDEMDALIEEI------DGISNRTEFNGKKLLDGTNS----------- 142
gi 157691931  81 TETHSILQRVRELVVQAGNTGTQD-DTDLGAIQEEIKNLVQEIgngtekNGISDRTEFNGKKLLNGAFA----------- 148
gi 157691934  81 TETHSILQRVRELVVQAGNTGTQD-ETDLGAIQEEIDALVQEIgngtdkNGISDRTEFNGKKLLDGTFA----------- 148
gi 16080589   81 TETHAILQRVRELVVQAGNTGTQDkATDLQSIQDEISALTDEI------DGISNRTEFNGKKLLDGTYKv---------- 144
gi 157691932  81 TETHSILQRVRELVVQAGNTGTQD-GTDLGAIQEEIANLVQEIgdgsgkNGISDRTEFNGKKLLDGTFS----------- 148
gi 157690947  81 TETHSILQRVRELVVQAGNTGTQQ-GEDLTAIKDEITALVDEV------DGISNRTEFNGKKLLNGTFNgtgtpgtpgtp 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52082071  145 --------adPANPAAGEKSLVFQIGANATQQISVNIEKMSTDALGVKDpadtTGRTLVTNQSVKDIDVTKFaDNAATAT 216
gi 52787460  145 --------adPANPAAGEKSLVFQIGANATQQISVNIEKMSTDALGVKDpadtTGRTLVTNQSVKDIDVTKFaDNAATAT 216
gi 157691933 154 -----------------TDTLTFQIGANKAQKLDVNIKAMSADKIGTDP----TDAT----KTVSAIKVTDF-ATIAAGA 207
gi 305676139 143 -----------------TDGFTFQIGANAGQQLNVKIDSMSSTALGVNA-----------------LDVTDF-------A 181
gi 157691931 149 ---------------DGTATLTFQIGANKAQKLDVNIEAMSSDKIGATQ----ADGTLVTGQAVSNIDVTQF---AAATP 206
gi 157691934 149 ----------AEPEGGEAKKLTFQIGANGAQQLSVHIEAMSADKLGVED------------KTVSTIKVTDF-AEIAADE 205
gi 16080589  145 ----------DTATPANQKNLVFQIGANATQQISVNIEDMGADALGIKE----ADGSIAALHSVNDLDVTKFaDNAADTA 210
gi 157691932 149 ------------AAGATPKSLTFQIGANKAQKLDVNIEAMSSTALGALE----ADGTLKADHAVADIDVTQF-ADPTAAG 211
gi 157690947 154 adseagtpeiPATPATDGEALVFQIGANATQQIKVNIQDMSAAALGVAG----TDGKTETGKSVKDIDVSKF-ETIAADE 228
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52082071  217 DVGFDTQLKIVDSAINQVSAQRAKLGAVQNRLEHTINNLGASSENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLA 296
gi 52787460  217 DVGFDTQLKIVDSAINQVSAQRAKLGAVQNRLEHTINNLGASSENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLA 296
gi 157691933 208 AGGFNDQLDIVDNAIKQVSDQRSKLGAVQNRLEHTINNLGASSENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLA 287
gi 305676139 182 ATAFDDQLKSIDTAINTVSTQRAKLGAVQNRLEHTINNLGASGENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLA 261
gi 157691931 207 TLTFDQQLDIVDGAIKQVSDQRSKLGAVQNRLEHTINNLGASGENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLA 286
gi 157691934 206 EGGFNDQLAIIDGAIKQVSDQRSKLGAVQNRLEHTINNLGASAENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLA 285
gi 16080589  211 DIGFDAQLKVVDEAINQVSSQRAKLGAVQNRLEHTINNLSASGENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLA 290
gi 157691932 212 ALSFDDQLDIVDGAIKQVSDQRSKLGAVQNRLEHTINNLGASGENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLA 291
gi 157690947 229 DGGFDDQLAIVDGAIKQVSAQRSKLGAVQNRLEHTINNLGASSENLTAAESRIRDVDMAKEMSEFTKNNILSQASQAMLA 308
                        330
                 ....*....|....
gi 52082071  297 QANQQPQNVLQLLR 310
gi 52787460  297 QANQQPQNVLQLLR 310
gi 157691933 288 QANQQPQNVLQLLR 301
gi 305676139 262 QANQQPQNVLQLLR 275
gi 157691931 287 QANQQPQNVLQLLR 300
gi 157691934 286 QANQQPQNVLQLLR 299
gi 16080589  291 QANQQPQNVLQLLR 304
gi 157691932 292 QANQQPQNVLQLLR 305
gi 157690947 309 QANQQPQNVLQLLR 322
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap