Conserved Protein Domain Family
fliL

?
PRK12785: fliL 
flagellar basal body-associated protein FliL; Reviewed
Statistics
?
PSSM-Id: 183743
View PSSM: PRK12785
Aligned: 20 rows
Threshold Bit Score: 197.584
Threshold Setting Gi: 163852466
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 170747254   1 MAKKPKKASAEEGETGAeGAPKGKKKLMIMVAVAVLVVGGAGAGAFVMMGrgdskqaaqggdhgggHGGGDAKGAGPEGK 80
gi 192292787   1 MADAEKPEEGAEAAEGG-APKSKKKLIIIIAAAAVLLLGGGGAYFFLFAG----------------HGEDAHQAEAAKEV 63
gi 163852466   1 MAKKPKKAPAAEGEEGA-AEAPKSKKKLIIIAAAVLLLGGGGGGFFFMKSraa-----------haDAHGEHGAEKLDPK 68
gi 218531222   1 MAKKPKKAPAAEGEEGA-AEAPKSKKKLIIIAAAVLLLGGGGGGFFFMKSraa-----------haDAHGEHGAEKLDPK 68
gi 240139803   1 MAKKPKKAPAAEGEEGA-AEAPKSKKKLIIIAAAVLLLGGGGGGFFFMKSraa-----------haDAHGEHGAEKLDPK 68
gi 254562218   1 MAKKPKKAPAAEGEEGA-AEAPKSKKKLIIIAAAVLLLGGGGGGFFFMKSraa-----------haDAHGEHGAEKLDPK 68
gi 188582488  21 MAKKPKKAPAAEGEEGS-AEAPKSKKKLIIIAAAVLLLGGGGGGFMFMKSraa-----------haDAHGEHAGEKVDPK 88
gi 209884528   1 MADEDQVEESAAEVAVE-AAPSSRRKIFMIAGAVVLALMVGALGWFVFLRs---------------HDETQHADAAAAKV 64
gi 91976163    1 MADSEKPEEGAEAAEGA-APKSKKKLIIIIAAAALLLIGGGAAAWFFLFAg---------------HKDDKHHAEAAEKV 64
gi 86750894    1 MADPDKPEDGAEAGEGG-APKSKKKLIIIAAAAALVLIGGGGGAWFFMSKg---------------HDAEKEHAEAAEKV 64
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 170747254  81 KPVVFVDVREMLLNLSPELPQdKGRFAKVRISLELKDAKVEEEVRPLMPRVEDALQVYMRELRASDITNSVGLFRLREEL 160
gi 192292787  64 KPPNFVEVPEIMVNLAGTPGE-RVQYLKAKVVLEVKDEKLAEQIKPNMPRITDLFQTYLRELRSGDLNGSVGMFRMKEEL 142
gi 163852466  69 AQAVFLDMRDMLVNLSPDPGAtKSNVLKLRVALELKDAKVEATVKPLMPRVEDAFQTYLREIRASDLAGSAGLYRLREEL 148
gi 218531222  69 AQAVFLDMRDMLVNLSPDPGAtKSNVLKLRVALELKDAKVEATVKPLMPRVEDAFQTYLREIRASDLAGSAGLYRLREEL 148
gi 240139803  69 AQAVFLDMRDMLVNLSPDPGAtKSNVLKLRVALELKDAKVEATVKPLMPRVEDAFQTYLREIRASDLAGSAGLYRLREEL 148
gi 254562218  69 AQAVFLDMRDMLVNLSPDPGAtKSNVLKLRVALELKDAKVEATVKPLMPRVEDAFQTYLREIRASDLAGSAGLYRLREEL 148
gi 188582488  89 AQAVFLDMRDMMVNLSPDPGAtKANVLKLRVALELKDAKVESTVKPLMPRVEDAFQTYLREIRASDLAGSAGLYRLREEL 168
gi 209884528  65 VPPVFLDVPDILVNLASNPGE-RIQYLKVKAVLELKEAPLVDKVKPSMPRVTDLFQTYLRELRANDLNGSVGLFRMKEEL 143
gi 91976163   65 KPPSFIEVPEIMVNLAGSPGE-RVQYLKAKIVLEVKDEKLVEQIKPTMPRITDLFQTYLRELRSGDLNGSVGMFRMKEEL 143
gi 86750894   65 KPPTFVEVPEIMVNLAGSPGE-RVQYLKAKIVLELKDEKLVEQIKPTMPRITDLFQTYLRELRSGDLNGSVGMFRMKEEL 143
                        170       180
                 ....*....|....*....|....
gi 170747254 161 LRRVNIALYPAKVDAVLFKDVIVQ 184
gi 192292787 143 TRRVNMAIAPAQVSAVLFKEVLVQ 166
gi 163852466 149 LRRVNIALHPAKAEAVLFKDVIVQ 172
gi 218531222 149 LRRVNIALHPAKAEAVLFKDVIVQ 172
gi 240139803 149 LRRVNIALHPAKAEAVLFKDVIVQ 172
gi 254562218 149 LRRVNIALHPAKAEAVLFKDVIVQ 172
gi 188582488 169 LRRVNIALHPAKAEAVLFKDVIVQ 192
gi 209884528 144 TKRVNVAIAPERVNAVLFKEVVIQ 167
gi 91976163  144 TRRVNVAIAPAQVSALLFKEVLVQ 167
gi 86750894  144 TRRVNVAIAPAQVTAVLFKEVLVQ 167
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap