Conserved Protein Domain Family
PRK12740

?
PRK12740: PRK12740 
elongation factor G; Reviewed
Links
?
Statistics
?
PSSM-Id: 237186
View PSSM: PRK12740
Aligned: 366 rows
Threshold Bit Score: 625.227
Threshold Setting Gi: 294677032
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
111221565   1 MGHTGAGKTALVDRLLATAGPPERQNGDHQLAhtSYVGHADPDHRPSRSVSLSLCSVSHRGLTVNLLDTPGYPDFVGELR 80 
34540689   15 LGSSGAGKTTLAEAMLFEGGVIKRRGSIDAGN--TVCDYFPVEKEYGYSVFSTVFSVEWQDKKLNFIDCPGADDFIGGTV 92 
188994878  15 LGSSGAGKTTLAEAMLFEGGVIKRRGSIDAGN--TVCDYFPVEKEYGYSVFSTVFSVEWQDKKLNFIDCPGADDFIGGTV 92 
294673366  15 IGSAGSGKTTLAESMVYEAGIIKRRGSVESKN--TMSDYFPVEQEYGYSVFSTVFHVEWNNKKLNIIDCPGSDDFVGGSI 92 
302346344  15 VGSAGSGKTTLAESMLFEAGVIKRRGSVEAKN--TVSDYFPVEQEYGYSVFPTVFHVEWNNKKLNIIDCPGSDDFVGGAI 92 
53715151   15 LGNDGSGKTTLTEALLYESGIIKRRGRITAKN--TVSDYFPVEQEYGYSVFSTIFHVEWNGKKLNIIDCPGSDDFVGAAM 92 
60683086   15 LGNDGSGKTTLTEALLYESGIIKRRGRITAKN--TVSDYFPVEQEYGYSVFSTIFHVEWNGKKLNIIDCPGSDDFVGAAM 92 
150010331  15 LGSSGSGKTTLAEAMLYEGGVIKRRGSVEAGN--TVSDYFPVEKEYGYSVFSTVFSVEWQDRKLNFIDCPGSDDFVGGAV 92 
255536575  14 LGHSDSGKTTLIETMLYEGGAIKRRGSVEGQN--TVSDHTDLEHEKGKTIFSHQMFVNWKNNKINIIDTPGFDDFVGEVV 91 
256426051  15 LGAAKSGKTTLCETMLFEAGIISRRGTVEEGN--TVSDYHDVEHERGSSVYATCLHTEWRDYKINIIDTPGLEDFIGEII 92 
111221565  81 AGLRAADAALFVVSAVDGVDGATGLLWSECAEVGMPRAIAITHLDQARADFTAAVEECQRAFGTGVLPAWLPsRAAGGGV 160
34540689   93 SALNVTDCALVVVNAQYGVEVGLINQFRYVEQLHKPAIFIINQLDQDKADFDSAVSQLRERYGSKIVPVQYPvNAGAGFN 172
188994878  93 SALNVTDCALVVVNAQYGVEVGLINQFRYVEQLHKPAIFIINQLDQDKADFDSAVSQLRERYGSKIVPVQYPvNAGAGFN 172
294673366  93 TAMNVTDQAVILINGQYGPEVGTMNAFRNTEKLKKPVIFLVNQLDRENCDFDQILNQLKEIYGPNCVPVQYPiATGPGFN 172
302346344  93 TALNVTDEAVILINGQYGPEVGTQNNFRYTEKLKKPVIFLINQLDSDKCDFDNLISTMQEIYGSKCVPVQYPiETGPGFN 172
53715151   93 TALNVTDTAILLLNGQYGAEVGTQNHFRYTEKLGKPVIFLVNQLDNEKCDYDMVLEQLKSIYGPKVVPVQYPlATGPNFN 172
60683086   93 TALNVTDTAILLLNGQYGPEVGTQNHFRYTEKLGKPVIFLVNQLDNEKCDYDMVLEQLKSIYGPKVVPVQYPlATGPNFN 172
150010331  93 SALNVTDTALMVLNAQYGVEVGTVNQFRYTEQFHKPVIFVVNQLDNDKADYEGTIAQLKDRWGSKIVPIQYPiSCGSSFN 172
255536575  92 SSLKVADTAVIVLNAANGVEVGTELVWEYVEKYQTPAIFVINQMDHPKADFERTLEQAKERFGSKLVPLQYPyNSGSNFN 171
256426051  93 SSIRVCDTALLLLNAQHGVEVGTEQIWDYVDKYQKPTILAVNQLDTEQANFSRTVEEARRVFGSAVTVMQYPvDQGPGFN 172
111221565 161 RMTGLLSGRIVEY--GPGGRRESAAESDRSDvRHAAARAALVEGIIAesEDETLLDRYLAGADPDPDLLLADLEKAVAHG 238
34540689  173 AVVDVLKMKMYRWkpEGGVPEVLEIPAEEQD-KAKEMHQALVEAAAE--NDESLMEKFFDQGSLSEEEMRDGIRAGLISQ 249
188994878 173 AVVDVLKMKMYRWkpEGGVPEVLEIPAEEQD-KAKEMHQALVEAAAE--NDESLMEKFFDQGSLSEEEMRDGIRAGLISQ 249
294673366 173 AVIDVLLMKKYSWkpEGGAPIIEDIPADQLE-KAKEMKAKLVEAAAA--GDDTLMEKFFESEDLSEDEMREGIRKGMVTR 249
302346344 173 SLIDVLLMKKYSWkpEGGEPIIEDIPADQMP-KAMELHKALVEAAAE--NDEGLMEKFFEEETLTEDELRTGIRKGLVTR 249
53715151  173 SLIDVLLMKKYSWapeGGAPIIEEIPAEEKD-KAMELHKALVEAAAE--NDEGLMEKFFEQDSLTEDEMREGIRKGLAAR 249
60683086  173 SLIDVLLMKKYSWgpeGGAPTIEEIPAEEMD-KAMEMHKALVEAAAE--NDEGLMEKFFEQDSLTEDEMREGIRKGLAAR 249
150010331 173 AVVDVLKMKMYRWkpEGGVPDVLEIPAEEMD-KAMELHQALVEAAAE--NDDMLMEKFFEEGALSEDDMRAGIRAGLVTR 249
255536575 172 AIIDALRMVMYEFplnGGKPEKKPIPETEMV-RANEMHNALVEIAAE--NEEGLMEKYFEEGNLSEDDLAKGITIALAKQ 248
256426051 173 SVIDLLKMTMYRFpenGGKPEKLPIPDSEKE-QAERLHNELVEKAAE--NDDTLMEQYFEKGSLDEDEMRQGLKIGMLKH 249
111221565 239 TFFPVLpigllterRADhdrgerdgnqrdgnqrdrngrdrnervaedrgpaLAGGFGSTELLDLFVQGFPAPAEhpLPV- 317
34540689  250 GMYPVF--------CVS----------------------------------AEKDMCVRRTLEFLGNVVPGVNK--LPAp 285
188994878 250 GMYPVF--------CVS----------------------------------AEKDMCVRRTLEFLGNVVPGVNK--LPAp 285
294673366 250 SIFPVF--------CVC----------------------------------AGKDMGVRRLMEFLGNVVPFVSD--MPVi 285
302346344 250 SIFPVF--------CVC----------------------------------AGKSMGVRRLMEFLGNVVPFVDE--MPK- 284
53715151  250 GMFPVF--------CVC----------------------------------AGKDMGVRRLMEFLGNVVPGVSE--MPK- 284
60683086  250 GMFPVF--------CVC----------------------------------AGKDMGVRRLMEFLGNVVPGVSE--MPK- 284
150010331 250 GMFPVF--------CVC----------------------------------AGRDMCVRRTLEFLGNVVPCTDK--MPRl 285
255536575 249 QFFPVF--------VTS----------------------------------GLKDMGSGRLMGFIDDIAPSPAE------ 280
256426051 250 HVFPVF--------CLS----------------------------------ALHNMGSGRLMGFIDNVAPAAID------ 281
111221565 318 --LTRPDGTACDPATGDPAGPLVAEVVKTTTDPYvGRMSVVRVFSGTLHPDDHVHVSGhgraaaghadHDDDERVGALSR 395
34540689  286 vaVSGEE------VKPDASAPLCIHFFKTTIEPHiGEVSYFKVMSGTLTEGVDLLNAD----------RGSKERISQIFV 349
188994878 286 vaVSGEE------VKPDASAPLCIHFFKTTIEPHiGEVSYFKVMSGTLTEGVDLLNAD----------RGSKERISQIFV 349
294673366 286 qnAAGQD------VPADASAPASLYFFKTGVEPHiGEVSYFKVMSGSVKSGDDFTNAD----------RGSKERIGTIYA 349
302346344 285 --IHNTRGEE---VTPDSNGPESLYFFKTGMEPHiGEVSYFKVMSGCVKSGDDLTNSD----------RGSKERMGQLYA 349
53715151  285 --VHNTRGEV---VEPDPNGPTSLYFFKTGVEPHiGDVQYFKVMSGKVHEGDDFTNAD----------RGSKERVAQIYA 349
60683086  285 --VHNTRGEV---VEPDPNGPTSLYFFKTGVEPHiGDVQYFKVMSGKVHEGDDFTNAD----------RGSKERVAQIYA 349
150010331 286 itTEGVE------VTPDSNGPTSLFFFKTTVEPHiGQVSYFKVISGKVKEGDDLMNAD----------RGSKERIAQLFA 349
255536575 281 --RPARKLENGDEISYDPNDKTTIFIYKTLSEPQvGMVSYFKVLSGKLKPGDELVNAN----------NGETERISQLFV 348
256426051 282 --MPAEQAEDGSPIPCDPSASPVLFVFKTLQEPHiGRLSFFKVLAGEIKAGVELYSEK----------GNTVERLNQLFI 349
111221565 396 PYGSVLHSVPDCPAGGICVVTKLATAETGDTLSN-LDDPRHLPAWTMPEPLLPIAIRARGRADEDRLATALSRLAVEDPT 474
34540689  350 PAGQQRIKVDQMCAGDIGATVKLKEVRRGNTLNE-KGVEHRFDLVKFPEPKYRRAIRAANESDTEKMNAALNEMREEDPT 428
188994878 350 PAGQQRIKVDQMCAGDIGATVKLKEVRRGNTLNE-KGVEHRFDLVKFPEPKYRRAIRAANESDTEKMNAALNEMREEDPT 428
294673366 350 CAGANRIQVDQLVAGDIGCTVKLKDVKTGNTLNG-KDVENKFNFIKYPNSKFSRAIKAVNESETEKMMTALQKMRQEDPT 428
302346344 350 CAGANRIPVDQLNAGDLGCTVKLKDVKTGNTLNG-KGTDQRFDFIKYPNSKYSRAVEAKSSQETEKLMAALLKMRQEDPT 428
53715151  350 CAGANRIKVEEMVAGDIGCTVKLKDVHTGNTLNG-KGAENRFNFIKYPNSKYSRAIKPVNEADTEKMMAILNRMREEDPT 428
60683086  350 CAGANRIKVEEMVAGDIGCTVKLKDVHTGNTLNG-KGAENRFNFIKYPNSKYSRAIKPVNEADTEKMMAILNRMREEDPT 428
150010331 350 VAGQTRTPVTEMVAGDIGATVKLKDVRRGNTLNG-KGCDYRFDFIKYPDPKYRRAIKPVNEADAEKMMEILIRMREEDPT 428
255536575 349 AEGKDRIPVDELVAGDLGVTVKLKFGHSNNTLNS-KGLDRKVRPMEFPESRIRKAVSADSTAAMEKLVTALHKIEEEDPT 427
256426051 350 TDGRNRHPAEVLRAGDIGCTLKLKNTLTNHTLLAdKQSGKQVKPIGFPTPKVRVAIEATNKADDEKLSEVLAELHMEDPT 429
111221565 475 LRVVQDPETAQLVLWSMGEAHAESVLERLAQRYGATVDRVPTVIPLRETLRAPARGLGRQVKQSGGHGQYAVCQIEVEPL 554
34540689  429 WIVEQSKELRQTIVSGQGEFHLRTLKWRLEHNEKIEIEYIEPRIPYRETITKAARADYRHKKQSGGAGQFGEVHLIVEPY 508
188994878 429 WIVEQSKELRQTIVSGQGEFHLRTLKWRLEHNEKIEIEYIEPRIPYRETITKAARADYRHKKQSGGAGQFGEVHLIVEPY 508
294673366 429 WVVEQSKELRQIIVHGQGEFHLRTLKWRMENNEKIQIEYIEPKIPYRETITKMARADYRHKKQSGGAGQFGEVHLIVEPY 508
302346344 429 WVVEQSKELKQTIVHGQGEFHLRTLKWRLENNEKLQVTFKEPKIPYRETITKQSKAEYRHKKQSGGAGQFGEVHLIVEPY 508
53715151  429 WVIEQSKELKQTIVHGQGEFHLRTLKWRLENNEKLQVKFEEPKIPYRETITKAARADYRHKKQSGGAGQFGEVHLIVEPY 508
60683086  429 WVIEQSKELKQTIVHGQGEFHLRTLKWRLENNEKLQVKFEEPKIPYRETITKAARADYRHKKQSGGAGQFGEVHLIVEPY 508
150010331 429 WVIEQSKELKQTIVSGQGEFHLRTLKWRIENNDKLPIEYLEPKIPYRETITKAARADYRHKKQSGGAGQFGEVHLIIEPY 508
255536575 428 LKVEQSAELKQTILHGQGQLHLDLVKQRLQKDFGVKMNFDNPKIPYRETITGNADADYRHKKQSGGSGQFGEIHMRVENY 507
256426051 430 LEIEYNRELKQVILHGQGDLHLALTKWRLLNIYKMHVEFLPAKIPYRETIRKHAAATYRHKKQSGGAGQFGEVFITIEPY 509
111221565 555 P--PG---------------------------SG----FEFVDEVVGGAIPRSFIPSVEKGVRAQMAQGVRAGHPLTDLR 601
34540689  509 SddKPlpesfkfggqefritprdtqvvelewgGK----LVFVNSVVGGAIDMRFMPAILKGIMSRMEQGPLTGSYARDVR 584
188994878 509 SddKPlpesfkfggqefritprdtqvvelewgGK----LVFVNSVVGGAIDTRFMPAILKGIMSRMEQGPLTGSYARDVR 584
294673366 509 T--EGmpdptsfkingqefkmnikgkeevsldWGg--kLVFINSVVGGAIDMRFMPAILKGIMERMEQGPLTGSYARDVR 584
302346344 509 A--EGmpdpttykfngqefkmnikgreerdlpWGg--kLVFINSVVGGAIDARFMPAILKGVMDCMERGPLTGSYARDVR 584
53715151  509 Y--EGmpvpdmykfggqe--fkinvkgteevpLEwggkLVFVNSIVGGSIDARFLPAILKGIMSRMEQGPLTGSYARDVR 584
60683086  509 Y--EGmpvpdmykfggqe--fkinvkgteevpLEwggkLVFVNSIVGGSIDARFLPAILKGIMSRMEQGPLTGSYARDVR 584
150010331 509 Y--EGmpapdtyrfggqeykmnvrdtqiidldWGg--kVVFVNCIVGGAIDARFLPAILKGIMARMEQGPLTGSYARDVR 584
255536575 508 Y--DDmpeptgvn-----------irqkdieeLPwggkLAFYWCIVGGAIDNRYIGAIKKGIMQQMKEGPLTGSHCQNVR 574
256426051 510 Y--DGmppyrehp-----------vreteeiaLNwggkLVFNNCIVGGAIEARFLPSILKGVMEKMQEGPLTGSYVRDIR 576
111221565 602 VRLVDGKSHSVDSSDMAFQIAGGLALRDAVRSGGVVVLEPVLAVDVSVPDEFVGTVVSDLSTRRGRVVGMDPVPppPGsa 681
34540689  585 VVVYDGKMHPVDSNEVSFMLAGRNAFSTAFKEAGPKILEPVYDVEVSVPADYLGDVMSDMQGRRAIIMGMNSRKgyEQ-- 662
188994878 585 VVVYDGKMHPVDSNEVSFMLAGRNAFSTAFKEAGPKILEPVYDVEVSVPADYLGDVMSDMQGRRAIIMGMNSRKgyEQ-- 662
294673366 585 VIVYDGKMHPVDSNELSFMLAARNAFSAAFKEAGPKVLEPIYDLEVLVPGDYMGDVMSDLQGRRAIIMGMDSEAgyQK-- 662
302346344 585 VIVFDGKMHPVDSNELSFTLAARHAFSDAFKAAGPKILEPIYDLEVYVPGDYMGDVMSDLQGRRAMIMGMDSEAgyQK-- 662
53715151  585 VIVYDGKMHPVDSNEISFMLAGRNAFSEAFKNAGPKILEPIYDVEVFVPSDKMGDVMGDLQGRRAMIMGMSSENgyEK-- 662
60683086  585 VIVYDGKMHPVDSNEISFMLAGRNAFSEAFKNAGPKILEPIYDVEVFVPSDKMGDVMGDLQGRRAMIMGMSSENgyEK-- 662
150010331 585 ICVYDGKMHPVDSNEISFMLAGRNAFSTAFKEAGPKILEPVYDVEVSVPADYLGDVMSDLQGRRALIMGMNSEKgfEK-- 662
255536575 575 VTVYDGKMHSVDSNDISFQLAASGAFREGFQAAKPQLLEPVYSVEILCPDEDTGDVMGDLQTRRAMISGMDSEG--HY-- 650
256426051 577 VSVYDGKMHPVDSNDISFKIAGMMAFRDAFHQAAPQLLEPVFDIDITAADTMAGDVMSELQSRRSIITGMDSQN--GY-- 652
111221565 682 ssfaatrTVVHAEVPESEMSRYAIELRSLSHGTGSFHRQPHGYEPMPPQLADSLLG 737
34540689  663 ---------LLAKVPLKELSNYSTSLSSITGGRASFTMKFASYELVPADVQERLLK 709
188994878 663 ---------LLAKVPLKELSNYSTSLSSITGGRASFTMKFASYELVPADVQERLLK 709
294673366 663 ---------LSAKIPLKELSSYSIALSSITGGRASFSTSFSSYELVPNDIQQALIK 709
302346344 663 ---------LQAKIPLKELANYSISLSSLTGGRASFTTKFASYELVPNDIQQKLIA 709
53715151  663 ---------LVAKVPLKEMSSYSTALSSLTGGRASFIMKFASYELVPSDVQDKLIK 709
60683086  663 ---------LVAKVPLKEMSSYSTALSSLTGGRASFIMKFASYELVPSDVQDKLIK 709
150010331 663 ---------LLAKVPLKEMSNYSTSLSSITGGRASFTMKFASYELVPADVQEKLLK 709
255536575 651 -------QKILAEVPLAELHDYGSTLRSITGGRAKFTMKFSEYQLVPPNVQQELVK 699
256426051 653 -------QVIKARTPQAELDKLYAALRNVTQGKAKIKAVFAEYAPVPPELQKKLSE 701
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap