Conserved Protein Domain Family
flgF

?
PRK12689: flgF 
flagellar basal body rod protein FlgF; Reviewed
Statistics
?
PSSM-Id: 183684
View PSSM: PRK12689
Aligned: 20 rows
Threshold Bit Score: 422.234
Threshold Setting Gi: 254562217
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
92116937    1 MENTLLIGLSRQMMLERQMDVVANNVANVTTNGYKADRSLFEEYLMPGAHEDNFVGRDRRLSFVQDRATFHDFAGGPTEQ 80 
148256791   1 MENALLIGLSRQMVLERQLDVVANNVANVNTNGFKADQQLFEEYLSSKAHEDNFPGASRKVSYVQDRGTYRDFSQGSAQH 80 
27380938    1 MQNALLIGLSRQMTLERQMDVIANNVANANTNGFKADHSLFEEFLNSNAREDNFVGSDRRVSYVQDRGTFRDVGQGPMEA 80 
170742326   1 MQNAQLIGLSAQMALGRELEVIANNMANVSTTGFKGRTTHFQEYLMPKARAETFRMPDRRLSYVIDAGTPLDLAQGPIES 80 
240139802   1 MQNALFVGVSAQTALARELDVIANNMANVSTTGFKARSSRFQEYLMPVASADSFQRSDRRLSYVIDQGTPLDLTQGPVEP 80 
163852465   1 MQNALFVGVSAQTALARELDVIANNMANVSTTGFKARSARFQEYLMPVASADSFQRSDRRLSYVIDQGTPLDLTQGSVEP 80 
254562217   1 MQNALFVGVSAQTALARELDVIANNMANVSTTGFKARSARFQEYLMPVASADSFQRSDRRLSYVIDQGTPLDLTQGPVEP 80 
218531221   1 MQNALFVGVSAQTALARELDVIANNMANVSTTGFKARSARFQEYLMPVASADSFQRTDRRLSYVIDQGTPLDLTQGPVEP 80 
220924579   1 MQNAQLIGLSAQVALGRELEVIANNMANVSTTGFKARTTRFQEYLMPKASAETFRRPDRRLSYVIDAGTPLDLSQGPIET 80 
188582487   1 MQNALFVGVSAQAALARELDVIANNMANVSTTGFKARSARFQEYLMPVASADSFQRSDRRLSYVIDQGTPLDLTQGPVEP 80 
92116937   81 TKNPLDVAIDGKAFLVVQTPAGERYTRDGGLQINAQGQLVTASGNPVLGSNGPITFQQTDHDITISNDGTVTVLEGvNNA 160
148256791  81 TGNALDVAISGNGFLTVQTAAGERYTRDGNLHMNNLGQLVTAAGDLVLGTGGPIVLQPTDHDINISPDGTVTVVEG-VNR 159
27380938   81 TNNPLDMAINGNAFFAVQANGAERYTRDGKFTLSSTGQLVTSDGNLVLGTAGPITFQPTDHDINIAPDGTVTVLEG-TAK 159
170742326  81 TGNPLNAAIRGDAFFAVQTPQGERYTRNGAFELNAQGQLVTSDGNLVLGEGGPIQINPQETGLAIGADGTVSTSQG---- 156
240139802  81 DSNPMHVALRGDAFLAVQTPQGLRYTRNGAFELDATGNLVTSDGHAVQGDGGPITIGQQETGLAIAPDGTISTNLG---- 156
163852465  81 DSNPMHVALRGDAFLTVQTPQGLRYTRNGAFELDATGNLVTSDGHAVQGDGGPITIGQQETGLAIAPDGTISTNLG---- 156
254562217  81 DSNPMHVALRGDAFLAVQTPQGLRYTRNGAFELDATGNLVTSDGHAVQGDGGPITIGQQETGLAIAPDGTISTNLG---- 156
218531221  81 DSNPMHVALRGDAFLAVQTPQGLRYTRNGAFELDATGNLVTSDGHAVQGDGGPITIGQQETGLAIAPDGTISTNLG---- 156
220924579  81 TGNPLNAAIRGDAFFAVQTPQGERYTRNGAFELNAQGQLVTSDGNLVLGDGGPIQFNPQETGAAIGPDGTISTNQG---- 156
188582487  81 DGNPMHVALRGDAFLAVQTPQGVRYTRNGAFELNAQGNLVTSDGYAVQGDGGPITIGQQETGLSIAPDGTVSTNLG---- 156
92116937  161 ADSIRGKLRLVSFAQAQKLLKEGSNLYSAGAGNSArPDTSARVHQGFIEKSNVNAVTEMSRMVEVSRAYTQMATLLQQQS 240
148256791 160 TDSIRGKLKLVSFADPQQAQKQGNNLYSAAGGVTPqPDTKSTVQQGYIEKSNVSAVGEMSRMVEVMRSYTQVANMLQVQS 239
27380938  160 TDSIRGKIRMVTFDDPAKLTKLGANLYSAGSANQQ-VDTKSTVQQGYIEKSNVNSVGEMSRMVEVMRSYTAIANLLQQQS 238
170742326 157 ---NRGRIRLVAFADPRQLTNAGANLYAASAPPRP-AGPLARIEPGALERSNVSPVLTMTRMMEVNRVYALVADTIARMD 232
240139802 157 ---IRGRLRLVTFANAQALKSEGANLFSSEAPGRP-AGPGAHLEPGALERSNVKPVVEMTRLMDVNRTYSMVSSVISRLD 232
163852465 157 ---IRGRLRLVTFPNAQALKSEGANLFSSEAPARP-AGPGAHLEPGALERSNVKPVVEMTRLMDVNRTYSMVSSVISRLD 232
254562217 157 ---IRGRLRLVTFANAQALKSEGANLFSSEAPARP-AGAGVHLEPGALERSNVKPVVEMTRLMDVNRTYSMVSSVISRLD 232
218531221 157 ---IRGRLRLVTFANAQALKSEGANLFSSEAPARP-AGPGAHLEPGALERSNVKPVVEMTRLMDVNRTYSMVSSVISRLD 232
220924579 157 ---NRGKLRLVRFSDPQALSNAGANLYAATAAPLP-AGTQARVEPGAVERSNVSPVLTMTRMMEVNRIYALVSDSVSRMD 232
188582487 157 ---IRGRLRLVTFANPQALKSEGANLFSSDAPARA-AGPGQHLEPGALERSNVKPVVEMTRLMDVNRTYTMVSSVISRLD 232
92116937  241 DLQRSAIEKLADVPA 255
148256791 240 DMRKNAIEKLADVPA 254
27380938  239 DLHKSAIEKLADVPA 253
170742326 233 SLRGSAIQRLADVGN 247
240139802 233 DLRGTAIRRLADVA- 246
163852465 233 DLRGTAIRRLADVA- 246
254562217 233 DLRGTAIRRLADVA- 246
218531221 233 DLRGTAIRRLADVA- 246
220924579 233 ALRGSAIQRLADIGT 247
188582487 233 DLRGTAIRRLADVA- 246
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap