Conserved Protein Domain Family
flgB

?
PRK12627: flgB 
flagellar basal body rod protein FlgB; Provisional
Statistics
?
PSSM-Id: 237152
View PSSM: PRK12627
Aligned: 12 rows
Threshold Bit Score: 171.066
Threshold Setting Gi: 114798179
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 110677658   1 MFEKLEVFRMAHAMAVHAGEKQAVTAQNVANSDTPDYQARDVIPFsDTYsrdpanggwgsqkATRQTHINGAAAGQTPDP 80
gi 114798179   5 MISDLQLFQVYGAMARHAAESQKVSATNVANADAPGFKAGEIESF-EAF-------------LSRTMQAGGVDDMMSGFK 70
gi 119384842   1 MLDRIDTLRMASSLTAHAVERQKLIARNVANADTPGFRSRDLAGFaETYrshgp----tgmrASRPGHLTEGRGGDGAGR 76
gi 294679036   1 MFEKLEVFQMSQAMARHAALREGVVATNVANADTPGYRAKDVVSFaDSYrteha----qpmrATRPGHLGANGSYTVSVI 76
gi 77464909    1 MFEKLVIVRMAQSMARHAGLRTEVVAHNLANADTPGYRAQDLPDF-ESYasgt-----vglrTTRPGHLRSAEASATDPV 74
gi 126463751   1 MFEKLEIVRMAQSMARHAGLRTEVVAHNLANADTPGYRAQDLPEF-ESYasgt-----vglrTTRPGHLRSAEASAADPV 74
gi 146278634   1 MFEKLELVRMAQAMARHAGARTDVIARNVANSDTPGYRARDLPDF-ESYaegr-----tglrGTRAGHLRSAAAVAAEPV 74
gi 221640830   1 MFEKLEIVRMAQSMARHAGLRTEVVAHNLANADTPGYRAQDLPDF-ESYasgt-----vglrTTRPGHLRSAEATAADPV 74
gi 56695105   10 MFSDLNVFKMAYAMATHAGTRQAVIAQNMANADTPGYRERDIAPFaETFareta---gtamqASRTSHLNGTAASAASWA 86
gi 99082805    1 MFERLNVFNIAYSMATHAGKRQALVSENIANADTPGYHAKDIKPFrEVFaasea---qgdmiASRGSHINGVNGSGFDWA 77
gi 89056689    1 MFEGLEIFQLASGLARHSASRQAVVAQNIANADTPGYRARDVADFqQTWrnmt-----aearEGR---------TEVPMR 66
gi 159045787   1 -MKNLTILNTASAMVAHANERHGVIARNIAHADTPGYRTQDLKDFtDSYremts----sglrATRDDHAFGAHRGLDLSV 75
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 110677658  81 IIDENGVGSPNGNTVSLENEMLKSLDAKRQHDRALAIYKSSLSILRATLSRS 132
gi 114798179  71 VGTSGAPADPNGNNVSLEREVFNSAEAMGQHNMALTVYSKSIDLLRTALGKP 122
gi 119384842  77 ITDAGGEPAPNGNTVSLEEEMFRSAAAKRQFDLSLAVTKSSLSLVRTSLGRR 128
gi 294679036  77 EDPAPDSSSPDGNGVSIEDEMVKAVDVKRQHDRALAIYKSSLNVLRASLGRG 128
gi 77464909   75 PVEGPGAASPNGNTVSLEDEMVRAVAARQQHELALAIYQSSSRLIRTSLGRS 126
gi 126463751  75 PVEGPGAASPNGNTVSLEDEMVRAVAARQQHEMALAIYQSSSRLIRTSLGRS 126
gi 146278634  75 PAGIMGTASPNGNSVSLEEEMVKAVSARQQHEMALSIYQSSSRLIRTSLGRS 126
gi 221640830  75 PVEGRGAASPNGNTVSLEDEMVRAVAARQQHEMALAIYQSSSRLIRTSLGRS 126
gi 56695105   87 PFETNAAGDPNRNNVSIEEQMLKAVEVKRQHDRALAIYKSSMNMLRVGLGRG 138
gi 99082805   78 VTTDESSVDPNNNSVSLEEQILNGIEAKRQHDRALAIYRSSMNILRASLGRS 129
gi 89056689   67 VIDARTPASPNGNSVSLEFEMLRGIEAQRAHSRALRVYGSAMTILRTSIGR- 117
gi 159045787  76 QTVLDTPVAPNGNSVSLEHEMIRMAENRHQHELALSVYKTSMSILRTSLGR- 126
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap