Conserved Protein Domain Family
flgB

?
PRK12619: flgB 
flagellar basal body rod protein FlgB; Provisional
Statistics
?
PSSM-Id: 183627
View PSSM: PRK12619
Aligned: 5 rows
Threshold Bit Score: 219.269
Threshold Setting Gi: 54297179
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 54294160    1 MAINLDSYFGIHAKALIARDQRASVLANNIANVNTPNFKARDVDFNEVLTATMAGNSQQLRVTSDQHINTNADFMTHLKY 80
gi 54297179    1 MAINLDSYFGIHAKALIARDQRASVLANNIANVNTPNFKARDVDFNEVLTATMAGNSQQLRVTSDQHISTNADFMTHLKY 80
gi 148358803   1 MAINLDSYFGIHAKALIARDQRASVLANNIANVNTPNFKARDVDFNEVLTATMAGNSQQLRVTSDQHISTNADFMTHLKY 80
gi 296106848   1 MAINLDSYFGIHAKALIARDQRASVLANNIANVNTPNFKARDVDFNEVLTATMAGNSQQLRVTSDQHISTNADFMTHLKY 80
gi 52841448    1 MAINLDSYFGIHAKALIARDQRASVLANNIANVNTPNFKARDVDFNEVLTATMAGNSQQLRVTSDQHINTNADFMTHLKY 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 54294160   81 RMTHHASLDGNTVDKDMETTEFARNALNYQASLSFLNGKIKSMLTALKGE 130
gi 54297179   81 RMTHHASLDGNTVDKDMETTEFARNALNYQASLSFLNGKIKSMLTALKGE 130
gi 148358803  81 RMTHHASLDGNTVDKDMETTEFARNALNYQASLSFLNGKIKSMLTALKGE 130
gi 296106848  81 RMTHHASLDGNTVDKDMETTEFARNALNYQASLSFLNGKIKSMLTALKGE 130
gi 52841448   81 RMTHHASLDGNTVDKDMETTEFARNALNYQASLSFLNGKIKSMLTALKGE 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap