Conserved Protein Domain Family
PRK12578

?
PRK12578: PRK12578 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 183606
View PSSM: PRK12578
Aligned: 13 rows
Threshold Bit Score: 736.27
Threshold Setting Gi: 11498050
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
288931562   1 MRVGIIGVGCSKFGVRDDVTLQELAFEAVKEAIEDAGISKEDIEMSVVGTAGTRSYELMPAVPINEYCGFTGKGPIRVEA 80 
15922750    3 RKVAVIGVGNSKFGKRDDVTIKELAWESVKEALEDANLAQKDIDITVIGSTAYRGTEIYPAPPVSEYCGLIGKSPIRVEA 82 
70607997    2 RKVAVIGVGHSKFGKRDDVSIQELAWESIKEAFEDAGVTQKDVNTVILGSTAYRGVELYPGPIVAEYSGLTGKVPMRVEA 81 
15899350    3 RRVAVIGVGNSKFGRRDDVSIQELAWESIKEALNDSGVSQSDIGLVVIGSTAYRGIELYPAPIVAEYSGLTGKVPLRVEA 82 
11498050    1 MRVGVIGVGCSRFGRRDDAVIQELAYEAVKEALDDAGITQDEVELSVVGSVNTRGYELMPAVPVNEYCGFAGKGPLRVEA 80 
146303171   3 RRVGIVGVGMSKFGKRDDVSVRELSWEAIMEALQDAGITQKDVDLVVAGSTAYRGVELYPAPPVSEYSSLTGKTPIRVEA 82 
238621106   3 RRVAVIGVGNSKFGRRDDVSVQELAWESIKEALNDSGVSQTDIELVVVGSTAYRGIELYPAPIVAEYSGLTGKVPLRVEA 82 
229586121   3 RRVAVIGVGNSKFGRRDDVSVQELAWESIKEALNDSGVSQTDIELVVVGSTAYRGIELYPAPIVAEYSGLTGKVPLRVEA 82 
229580604   3 RRVAVIGVGNSKFGRRDDVSVQELAWESIKEALNDSGVSQTDIELVVVGSTAYRGIELYPAPIVAEYSGLTGKVPLRVEA 82 
227828914   3 RRVAVIGVGNSKFGRRDDVSVQELAWESIKEALNDSGVSQTDIELVVVGSTAYRGIELYPAPIVAEYSGLTGKVPLRVEA 82 
227831649   3 RRVAVIGVGNSKFGRRDDVSVQELAWESIKEALNDSGVSQTDIELVVVGSTAYRGIELYPAPIVAEYSGLTGKVPLRVEA 82 
229583460   3 RRVAVIGVGNSKFGRRDDVSVQELAWESIKEALNDSGVSQTDIELVVVGSTAYRGIELYPAPIVAEYSGLTGKVPLRVEA 82 
284999201   3 RRVAVIGVGNSKFGRRDDVSVQELAWESIKEALNDSGVSQTDIELVVVGSTAYRGIELYPAPIVAEYSGLTGKVPLRVEA 82 
288931562  81 ACATGSAAVYTAYSTIKSGIADVVIAIGVEKMNEVDTPTSLAVGGRSGSYLWEFHQYGTTFPGYYAMHASAHMARYGTTE 160
15922750   83 ACATGSSAAFTAINLIASGLADIVMAIGVDKMTEVDTSTSLAIGGRGGNYYWEFHMYGTTFPTYYALYATRHMALFGTTE 162
70607997   82 MCATGLAAALTAYSLVASGLAEIAMAVGVDKMTEVDTSTSLAVGGRGGNYQWEYHFYGTTFPTYYALYATRHMAVFGTTE 161
15899350   83 MCATGLAAALSAYTAVASGLVDIAMAVGVDKMTEVDTSTSLAIGGRGGNYQWEYHFYGTTFPTYYALYATRHMAVFGTTE 162
11498050   81 ACATGAAAVYTAYTSIASGMADVAIAIGVEKMTEVDTATSLAIGGRAGNYLWEFHQYGTTFPAYYAMHATAHMAKYGTTE 160
146303171  83 ACATGSAAAFTAINSIASGMVDVVLAVGFDKMTEVDTQTSLAIGGRGGNYEWEFHMYGTTFPAYYALYATRHMAVYGTTE 162
238621106  83 MCATGLAASLSAYTAVASGLVDMAIAVGVDKMTEVDTSTSLAIGGRGGNYQWEYHFYGTTFPTYYALYATRHMAVYGTTE 162
229586121  83 MCATGLAASLSAYTAVASGLVDMAIAVGVDKMTEVDTSTSLAIGGRGGNYQWEYHFYGTTFPTYYALYATRHMAVYGTTE 162
229580604  83 MCATGLAASLSAYTAVASGLVDMAIAVGVDKMTEVDTSTSLAIGGRGGNYQWEYHFYGTTFPTYYALYATRHMAVYGTTE 162
227828914  83 MCATGLAASLSAYTAVASGLVDMAIAVGVDKMTEVDTSTSLAIGGRGGNYQWEYHFYGTTFPTYYALYATRHMAVYGTTE 162
227831649  83 MCATGLAASLSAYTAVASGLVDMAIAVGVDKMTEVDTSTSLAIGGRGGNYQWEYHFYGTTFPTYYALYATRHMAVYGTTE 162
229583460  83 MCATGLAASLSAYTAVASGLVDMAIAVGVDKMTEVDTSTSLAIGGRGGNYQWEYHFYGTTFPTYYALYATRHMAVYGTTE 162
284999201  83 MCATGLAASLSAYTAVASGLVDMAIAVGVDKMTEVDTSTSLAIGGRGGNYQWEYHFYGTTFPTYYALYATRHMAVYGTTE 162
288931562 161 KQLAMVAVKNHRNAAKNPKAQFQKEITLEKALSSRYVAYPLRLFDCSAITDGSAAAILASEEKIKELGLkDQAVWIEGIG 240
15922750  163 EDMALASVKAHKYASLNEKAHFRNKITVEDVLKSRVISWPIKLLDSSPISDGSATVIFASEEKVRELKI-DTPIWVKGIG 241
70607997  162 EQMALVSVKAHKYGASNPKAHFQKPVTVEEVLKSRVISWPIKLLDACPISDGSATAIFASEEKVRELKI-DSPVWISGVG 240
15899350  163 EQMALVSVKAHKYGSMNPKAHFQKPVTVEEVLKSRVISWPIKLLDSCPISDGSATAVFASEEKVKELKI-DSPVWITGIG 241
11498050  161 EQMAKVAVKAHRNAARNPKAHFQKEIAVEDVLNSRYITYPLKLYDCSPISDGSAAAILASEEKIRELGI-DDVVWIDSVG 239
146303171 163 EDMALASVKAHKYASMNEKAHLRNRVTVEDVLKSRVISWPIKLLDSSPISDGAAAVIFASEEKIRELNV-DTPVWVEGIG 241
238621106 163 EQMALVSVKAHKYGAMNPKAHFQKPVTVEEVLKSRAISWPIKLLDSCPISDGSATAIFASEEKVKELKI-DSPVWITGIG 241
229586121 163 EQMALVSVKAHKYGAMNPKAHFQKPVTVEEVLKSRAISWPIKLLDSCPISDGSATAIFASEEKVKELKI-DSPVWITGIG 241
229580604 163 EQMALVSVKAHKYGAMNPKAHFQKPVTVEEVLKSRAISWPIKLLDSCPISDGSATAIFASEEKVKELKI-DSPVWITGIG 241
227828914 163 EQMALVSVKAHKYGAMNPKAHFQKPVTVEEVLKSRAISWPIKLLDSCPISDGSATAIFASEEKVKELKI-DSPVWITGIG 241
227831649 163 EQMALVSVKAHKYGAMNPKAHFQKPVTVEEVLKSRAISWPIKLLDSCPISDGSATAIFASEEKVKELKI-DSPVWITGIG 241
229583460 163 EQMALVSVKAHKYGAMNPKAHFQKPVTVEEVLKSRAISWPIKLLDSCPISDGSATAIFASEEKVKELKI-DSPVWITGIG 241
284999201 163 EQMALVSVKAHKYGAMNPKAHFQKPVTVEEVLKSRAISWPIKLLDSCPISDGSATAIFASEEKVKELKI-DSPVWITGIG 241
288931562 241 YSSDTANLSKRIDYVGLKATVEASRMAYKMAKIDDpvKQLDVAALHDCFTIAEIMAYEDLGFCKKGEGGKFIENGDSDFG 320
15922750  242 YSSDTSYIAARGEWVGLEAARDAAAKAYKMAKISP--LDIEYATVHDCFSIAEIMAYEDLGFVEKGKGAELLREGQTEKD 319
70607997  241 FANDYAYVARRGEWLGFKATTLAAQDAYKMADITP--NSIEVATVHDAFTIAEIMGYEDLGFVEKGKGGKFIEEGQSEKG 318
15899350  242 YANDYAYVARRGEWVGFKATQLAARQAYEMAKVTP--NDIEVATVHDAFTIAEIMGYEDLGFTEKGKGGKFIEEGQSEKG 319
11498050  240 YASDTSNMTNRESFVGLKATVLAREMAYRKAGIEEpvKQLDFATVHDCFTIAEIMAYEDLGFCRKGEGGKLVESGETELG 319
146303171 242 YGSDTSSIARRGEWTSLRAARDAANMAYSQSKRSP--RDVEYATVHDCFTIAEIMAYEDLGFAERGRGATLLREGQTEKG 319
238621106 242 YANDYAYVARRGEWVGFKATQLAARQAYNMAKVTP--NDIEVATVHDAFTIAEIMGYEDLGFTEKGKGGKFIEEGQSEKG 319
229586121 242 YANDYAYVARRGEWVGFKATQLAARQAYNMAKVTP--NDIEVATVHDAFTIAEIMGYEDLGFTEKGKGGKFIEEGQSEKG 319
229580604 242 YANDYAYVARRGEWVGFKATQLAARQAYNMAKVTP--NDIEVATVHDAFTIAEIMGYEDLGFTEKGKGGKFIEEGQSEKG 319
227828914 242 YANDYAYVARRGEWVGFKATQLAARQAYNMAKVTP--NDIEVATVHDAFTIAEIMGYEDLGFTEKGKGGKFIEEGQSEKG 319
227831649 242 YANDYAYVARRGEWVGFKATQLAARQAYNMAKVTP--NDIEVATVHDAFTIAEIMGYEDLGFTEKGKGGKFIEEGQSEKG 319
229583460 242 YANDYAYVARRGEWVGFKATQLAARQAYNMAKVTP--NDIEVATVHDAFTIAEIMGYEDLGFTEKGKGGKFIEEGQSEKG 319
284999201 242 YANDYAYVARRGEWVGFKATQLAARQAYNMAKVTP--NDIEVATVHDAFTIAEIMGYEDLGFTEKGKGGKFIEEGQSEKG 319
288931562 321 GKIPVNTFGGLKAKGHPLGATGVGMVYEIVKQLRGEAGELQVDLKNYKGLTHNIGGTGHFGWVFILGV 388
15922750  320 GKVAVNLFGGLKAKGHPLGATGLSMIYEVTKQLREEAGPVQHSFKRYVALTHNVGGTGHYAYVMIFNR 387
70607997  319 GKVGVNLFGGLKSKGHPLGATGLSMIYEITKQLREEAGSLQQPLKRYTGLVHNVGGTGHYAYVMVLRR 386
15899350  320 GKVGVNLFGGLKAKGHPLGATGLSMIYEITKQLRDEADKLQQPLKKYIGLVHNVGGTGHFAYVMILRR 387
11498050  320 GKLPVNTFGGLKAKGHPLAATGVAMVYEIVKQLRGEAGELQVELRNNRALLHNVGGTGHFAFVMIFGR 387
146303171 320 GKVAVNLFGGLKAKGHPLGATGLSMMYEVTKQLREEAGPVQQQFKNYVALTHNVGGTGHYAYVSILSR 387
238621106 320 GKVGVNLFGGLKAKGHPLGATGLSMIYEITKQLRDEADKLQQPLKKYIGLVHNVGGTGHFAYVMVLRR 387
229586121 320 GKVGVNLFGGLKAKGHPLGATGLSMIYEITKQLRDEADKLQQPLKKYIGLVHNVGGTGHFAYVMVLRR 387
229580604 320 GKVGVNLFGGLKAKGHPLGATGLSMIYEITKQLRDEADKLQQPLKKYIGLVHNVGGTGHFAYVMVLRR 387
227828914 320 GKVGVNLFGGLKAKGHPLGATGLSMIYEITKQLRDEADKLQQPLKKYIGLVHNVGGTGHFAYVMVLRR 387
227831649 320 GKVGVNLFGGLKAKGHPLGATGLSMIYEITKQLRDEADKLQQPLKKYIGLVHNVGGTGHFAYVMVLRR 387
229583460 320 GKVGVNLFGGLKAKGHPLGATGLSMIYEITKQLRDEADKLQQPLKKYIGLVHNVGGTGHFAYVMVLRR 387
284999201 320 GKVGVNLFGGLKAKGHPLGATGLSMIYEITKQLRDEADKLQQPLKKYIGLVHNVGGTGHFAYVMVLRR 387
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap