Conserved Protein Domain Family
PRK12558

?
PRK12558: PRK12558 
glutamyl-tRNA synthetase; Provisional
Statistics
?
PSSM-Id: 183594
View PSSM: PRK12558
Aligned: 88 rows
Threshold Bit Score: 659.238
Threshold Setting Gi: 170740840
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62289939    1 MTVTVRFAPSPTGYIHIGNTRTALSNWLYASKNNGKFILRYDDTDVERSKDEYAQAIAVDLDWLGVRPDRVEYQSKRFDI 80
gi 148285057  19 MTVITRFAPSPTGKLHIGNVRVALVNWLYAQKYNGNFILRIDDTDRDRSKVEYHEAIIKDLQWLGINWNSSFLQSIRFNK 98
gi 157803937   2 TKVITRFAPSPTGMLHVGNIRVALLNWLYAKKHNGQFILRFDDTDLERSKQEYKNAIEEDLKFLKINWDQTFNQLSRLSR 81
gi 157825574   2 TKVITRFAPSPTGMLHVGNIRVALLNWLYAKKHNGQFILRFDDTDLERSKQEYKDAIKDDLKFLNLHWDQTFNQLSRLSR 81
gi 157827242   2 TKVITRFAPSPTGMLHVGNIRAALLNWLYAKKHDGQFILRFDDTDLERSKQEYKDAIRADLKFLNLNWDQTFNQLSRLSR 81
gi 157964406   2 TKVITRFAPSPTGMLHVGNIRAALLNWLYAKKHNGQFILRFDDTDLERSKQEYKDAIEEDLKFLNINWDQTFNQLSRLSR 81
gi 229586592   2 TKVITRFAPSPTGMLHVGNIRAALLNWLYAKKHNGQFILRFDDTDLERSKQEYKDAIEEDLKFLNINWDQTFNQLSRLSR 81
gi 238651066   2 TKVITRFAPSPTGMLHVGNIRAALLNWLYAKKHNGQFILRFDDTDLERSKQEYKDAIEEDLKFLNINWDQTFNQLSRLSR 81
gi 67458921    2 TKIITRFAPSPTGMLHVGNIRAALLNWLYAKKHNGQFILRFDDTDLERSKQEYKDAIEEDLKFLNLNWDQTFNQLSRLSR 81
gi 91205526    2 TKVITRFAPSPTGMLHVGNIRAALLNWLYAKKHDGQFILRFDDTDLERSKQEYKDAIRADLKFLNLNWDQTFNQLSRLSR 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62289939   81 YAKAVEKLKTAGLLYACYETADELERRRKFRLARRLPPVYGREALKLTDAEKAALEAEGRKPHWRFLLpnfesdpfatQR 160
gi 148285057  99 YKAAKQYLISSGRLYECYETPEMLEIERKRQLTSGYPPIYSRKALELTKAQKVQLQAEGYKVHYRFLId---------RN 169
gi 157803937  82 YDVIKKLLLDKKRLYTCYETPEELELKRKVQLSKGLPPIYDRASLNLTTEQIKKYIEQGRKPHYRFLV----------NH 151
gi 157825574  82 YDEIKNLLLDKKRLYACYETPDELELKRKFQLSKGLPPMYDRASLNLTEEQTEKYIEQGRNPHYRFLV----------NH 151
gi 157827242  82 YDEIKKLLLDKKRLYACYETPEELELKRKFQLSKGLPPIYDRAALNLTEDQIQKYIEQGRKPHYRFLV----------NH 151
gi 157964406  82 YDEIKNLLLDKKRLYACYETPEELELKRKFQLSKGLPPIYDRASLNLTEEQAKKYIEQGRKPHYRFLV----------NH 151
gi 229586592  82 YDAIKNLLLDKKRLYACYETPEELELKRKFQLSKGLPPIYDRASLNLTEEQAKKYIEQGRKPHYRFLV----------NH 151
gi 238651066  82 YDAIKNLLLDKKRLYACYETPEELELKRKFQLSKGLPPIYDRASLNLTEEQAKKYIEQGRKPHYRFLV----------NH 151
gi 67458921   82 YDEIKNLLLDKKRLYACYETPEELELKRKFQLSKGLPPIYDRASLNLTEEQTQKYIEQGRKPHYRFLV----------NH 151
gi 91205526   82 YDEIKKLLLDKKRLYACYETPEELELKRKFQLSKGLPPIYDRAALNLTEDQIQKYIEQGRKPHYRFLV----------NH 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62289939  161 TEVHWDDLVRGPQTVDLASMSDPILVREDGTYLYTLPSVVDDIDMGVTHIIRGDDHVTNTGVQISIFKALGATPPVFGHH 240
gi 148285057 170 KPIIWNDLIKGEIKYDGSNISDPIVIKEDGTMIYMLCSVIDDIEYRISHIIRGEDHITNTAIQIQMFEALGAAIPQLGHL 249
gi 157803937 152 ELISWHDMIKGEVKYDGKALSDPIVIRADGSMTYMLCSVIDDIDYDITHIIRGEDHVGNTAIQIQMFEALNKIPPVFGHL 231
gi 157825574 152 EPISWHDMIKGEIQYDGKALSDPIVIRADGSMTYMLCSVIDDIDYDITHIIRGEDHVSNTAIQIQMFEALNNTPTTFGHL 231
gi 157827242 152 EPITWHDMIKGEVKYEGKALSDPIVIRADGSMTYMLCSVIDDVDYEITHIIRGEDHVSNTAIQIQMFEALDKYPPTFGHL 231
gi 157964406 152 ELINWHDMIKGEVKYDGKALSDPIVIRADGSMTYMLCSVIDDIDYDITHIIRGEDHVSNTAIQIQMFEALNTTPPTFGHL 231
gi 229586592 152 EPISWHDMIKGEVKYDGKALSDPIVIRADGSMTYMLCSVIDDIDYDITHIIRGEDHVSNTAIQMQMFEALNTTPPTFGHL 231
gi 238651066 152 EPISWHDMIKGEVKYDGKALSDPIVIRADGSMTYMLCSVIDDIDYDITHIIRGEDHVSNTAIQMQMFEALNTTPPTFGHL 231
gi 67458921  152 EPISWHDMIKGEVKYDGKALSEPIVIRADGSMTYMLCSVIDDIDYDITHIIRGEDHVSNTAIQIQMFEALNTTPPTFGHL 231
gi 91205526  152 EPITWHDMIKGEVKYEGKALSDPIVIRADGSMTYMLCSVIDDVDYEITHIIRGEDHVSNTAIQIQMFEALDKYPPTFGHL 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62289939  241 NLLTTISGEgLSKRTGALSVGSLR-EAGYEPMAVASLAILIGTSESVTAAPDMAALAEHFDLASISKSSAKFDPSELDAL 319
gi 148285057 250 SLIKSDSGK-ISKRIGGFTIDYLRdQLGIEPMAVNNLLALSGTSNNVDAYFSLESLITKFDLSAFSKSAIIYNENELVTL 328
gi 157803937 232 SLIINKDEK-ISKRIGGFEIATLRkQIGLEAMAIASFFSLLGSSSQILPYKNMDELATQFEISNFSKSPTMYQPEDLVRL 310
gi 157825574 232 SLIINKDEK-ISKRVGGFEITTLRkEIGIEAMAIASFFSLLGSSAQILPYKSMEKLINQFEISSFSKSPTIYQPKDLERL 310
gi 157827242 232 SLIINKDEK-ISKRVGGFEIATLReEVGLEAMAIASFFSLLGSSAQIIPHKKMDELVKHFEISSFSKSPTIYQPEDLERL 310
gi 157964406 232 SLIINKDEK-ISKRVGGFEIATLRkEVGIEAMAIASFFSLLGSSAQILPYKSMEKLANQFEISSFSKSPTIYQPEDLERL 310
gi 229586592 232 SLIINKDEK-ISKRVGGFEIATLRkEIGIEAMAIASFFSLLGSSAQILPYKSMEKLANQFEISSFSKSPTIYQPEDLERL 310
gi 238651066 232 SLIINKDEK-ISKRVGGFEIATLRkEIGIEAMAIASFFSLLGSSAQILPYKSMEKLANQFEISSFSKSPTIYQPEDLERL 310
gi 67458921  232 SLIINKDEK-ISKRVGGFEITTLRkEIGLEAMAIASFFSLLGSSAQILPYKSMEKLANQFEISSFSKSPTIYQPEDLERL 310
gi 91205526  232 SLIINKDEK-ISKRVGGFEIATLReEVGLEAMAIASFFSLLGSSAQIIPHKKMDELVKHFEISSFSKSPTIYQPEDLERL 310
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62289939  320 NRSLLHEMPFEKAKPRLEALGiCGAKAESFWLAVRGNLDRFSDVSHWWQVVSGdlPEAPDLSGEDRDFVRHAFDLLPPEP 399
gi 148285057 329 NHKLLVNTEYDTIKHRLTAIG-LPDVTKEFWLAVRHNLNTLNDIKIWWQICYL--PTLDKFQEQDAEFLKLAAGLLPSGK 405
gi 157803937 311 NHKLLISVDFDEVKERLKEID-ATYIDENFWLSVRPNLQKLRDVKDWWDICNQ--TPNVENLNLDKEYLKQAAELLPQGE 387
gi 157825574 311 NHKLLISLDFDEVKDHLKEID-AEYIDENFWLSIRPNLQKLRDVKDWWEICHH--TPNVESLNLDQEYLKQAAELLPQGA 387
gi 157827242 311 NHKLLISLEFNEVKDRLKEID-AEYIDENFWLSVRPNLKKLFDAKDWWEICHK--TPNIQDLNLDKEYLKQAAELLPEEE 387
gi 157964406 311 NHKLLISLDFDTVKERLKEIN-AEYIDENFWLSVSPNLQKLRDVKDWWEICHQ--TPNVENLNLDKEYLKQAAELLPKGE 387
gi 229586592 311 NHKLLISLDFDTVKERLKEID-AEYIDENFWLSVSPNLQQLRDVKDWWEICHQ--TPNVENLNLDKEYLKQAAELLPKGE 387
gi 238651066 311 NHKLLISLDFDTVKERLKEID-AEYIDENFWLSVSPNLQKLRDVKDWWEICHQ--TPNVENLNLDKEYLKQAAELLPKGE 387
gi 67458921  311 NHKLLISLDFDEVKNHLKEID-AEYIDENFWLSVRPNLQKLRDVKDWWEICHK--TPNVKSLNLDKEYLKQAAEVLPQGK 387
gi 91205526  311 NHKLLISLEFNEVKDRLKEID-AEYIDENFWLSVRPNLKKLFDAKDWWEICHK--TPNIQDLNLDKEYLKQAAELLPEEE 387
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 62289939  400 WNGQTWKSWTEAVKSATGRKGKNLFMPLRLALTGQAHGPELADLLVLVGLERTKSRRP 457
gi 148285057 406 LTDNSWDDWVQNIIKATNRRGKALFMPLRLALTGITYGPELKYLLPLIGGEEVKARLL 463
gi 157803937 388 ITKDSWRIWTKEITNITSRKGKELFLPLRLALTGRESGPEIAGILPLIDRKEIIKRLT 445
gi 157825574 388 ITKDSWSIWTKEITNITGRKGKELFLPLRLALTGRESGPEIADVLPLISREEIVKRLT 445
gi 157827242 388 ITTETWGIWTKKLAAITNRKGKELFLPLRLALTGKESGPEISKVLPLIKREEIVKRLT 445
gi 157964406 388 ITKDSWSIWTKEITNITGRKGKELFLPLRLALTARESGPEITGVLPLIDREEIIKRLT 445
gi 229586592 388 ITKDSWSIWTKEITNRTGRKGKELFLPLRLALTARESGPEIASVLPLIDREEIIKRLT 445
gi 238651066 388 ITKDSWSIWTKEITNITGRKGKELFLPLRLALTTRESGPEIASVLPLIDREEIIKRLT 445
gi 67458921  388 ITKDSWSIWTKEITNITGKKGKELFLPLRLALTGRESGPEIASVLPLIDREEIIKRLT 445
gi 91205526  388 ITTETWGIWTKKLAAITNRKGKELFLPLRLALTGKESGPEISKVLPLIKREEIVKRLT 445
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap