Conserved Protein Domain Family
PRK12555

?
PRK12555: PRK12555 
chemotaxis-specific methylesterase; Provisional
Statistics
?
PSSM-Id: 237135
View PSSM: PRK12555
Aligned: 80 rows
Threshold Bit Score: 437.005
Threshold Setting Gi: 116053894
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
34497961    3 VSVLIVDDSAVVREVLSQMLSSAPDIEVLGAAPDPIFAMTRMKQRWPDVIVLDIEMPRMDGLTFLRKIMDERPTPVIICS 82 
15595371    3 ISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLIKQHAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMIS 82 
116053894   3 ISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLIKQYAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMIS 82 
121998939   2 IRVLIVDDSALIRRLLAELFAAEEGIEVVGTARDPYDAREKIKQLNPDVLTLDVEMPRMDGITFLRNLMRLRPMPVVMVS 81 
152984656   3 ISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLIRQHAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMIS 82 
190574200   9 CRVLIVDDSAVVRQMLTEILSSDPAIDVVGTAADPLLAREKIKRLAPDVITLDVEMPRMDGLAFLENLMRLHPLPVVMIS 88 
194365620   9 CRVLIVDDSAVVRQMLTEILSSDPSIDVVGTAADPLLAREKIKRLAPDVITLDVEMPRMDGLAFLENLMRLHPLPVVMIS 88 
218888918   3 ISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLIKQHAPDVISLDVEMPRMDGLTFLDKLMKARPTPVLMIS 82 
285018138   7 CRVLIVDDSAVVRQILTEILSRAPGIEVVGSAADPLLAREKIKRLNPDVITLDVEMPRMDGLAFLENLMRLRPTPVVMIS 86 
288941944   2 IRVLVVDDSALMRQLLTEILESAPDIEVVGSAQDPYVARERIKALDPDVLTLDVEMPRMDGLTFLRNLMRLRPMPVVMVS 81 
34497961   83 SLTEKGARITLDALAAGAVAIITKPALNQRAFLLEAAKELVQEVRDAARAKMGVVkrisq-gaaeHAPPAPKltADVVLe 161
15595371   83 SLTERGSEATLRALELGAVDFIAKPRLGIAEGMQAYAEEIRAKLKTVARARLRRR----------AADAPAP--PESAA- 149
116053894  83 SLTERGSEATLRALELGAVDFIAKPRLGIAEGMQAYAEEIRAKLKTVARARLRRR----------AADAPAP--PESAA- 149
121998939  82 SLTEVGAEETLEALALGAVDFVTKPKADVSYALEGYRDEIVAKVRAAAQARVRPg----------PARSAAA--APPRP- 148
152984656  83 SLTERGSEATLRALELGAVDFIAKPRLGIAEGMQAYAEEIRAKLKTVARARLRRR----------AADAPAP--PESAA- 149
190574200  89 SLTERGADTTLQALALGAVDFVSKPKLDVARGLQGYADEIIAKVKMAARSRVRPL----------VRAAAPKllLEAAPa 158
194365620  89 SLTERGADTTLQALALGAVDFVSKPKLDVARGLQGYADEIIAKVKMAARSRVRPLvrtal-pkltLDAAPAM--RAATP- 164
218888918  83 SLTERGSEATLRALELGAVDFIAKPRLGIAEGMQAYAEEIRAKLKTVARARLRRR----------AADAPAP--PESAA- 149
285018138  87 SLTERGADTTLQALALGAVDFVSKPKLDVARGLEEYAEEIIGKVIAASKAKVRALdradilkpagPATVAPT--ALSSL- 163
288941944  82 SLTERGAEVTLHALELGAVDFVRKPDGPIAAGMREYADELIEKIRIAATIRVRPLq--------vAPAMTTEsqPRAIP- 152
34497961  162 apsgleKYRTTEKIIAIGTSTGGTQALEYLLPKLPATCPGVAVVQHMPEKFTASFAERLNRLCRVEVKEAQTGDRLISGV 241
15595371  150 ------PLLSTEKIIALGASTGGTEALKEVLLGLPAHSPGVVITQHMPPGFTRSFAERLDRLTRLSVSEARDGDRILPGH 223
116053894 150 ------PLLSTEKIIALGASTGGTEALKEVLLGLPAHSPGVVITQHMPPGFTRSFAERLDRLTRLSVSEARDGDRILPGH 223
121998939 149 ------HQRTTDKVVAIGASTGGTVAVQRLLEVMPPNAPATVITQHMPPGFSAAFAQRLDHLCAVSVHEAQDGQRVLPGH 222
152984656 150 ------PLLSTEKIIALGASTGGTEALKEVLLGLPANSPGVVITQHMPPGFTRSFAERLDRLTRLAVSEARDGDRILPGH 223
190574200 159 mrpaapQFRTTDRLIAIGSSAGGTEALRVVLEGMPADAPAVVMTQHLPASFSSAFAERLDRHSAMAVREASDGEAVLPGH 238
194365620 165 ------QFRTTDRLIAIGSSAGGTEALRVVLEGMPADAPAVVMTQHLPASFSSAFAERLDRHSAMAVREASDGEAVLPGH 238
218888918 150 ------PLLSTEKIIALGASTGGTEALKEVLLGLPAHSPGVVITQHMPPGFTRSFAERLDRLTRLSVSEARDGDRILPGH 223
285018138 164 ------KFRTTDRLIAIGASAGGTEALRVVLEGMPADAPAVVMTQHLPAGFSTAFADRLNRHSAMAVREASEGEAILPGH 237
288941944 153 ------SFRTTDRVLAIGASTGGTEAIKEVLMRLPPDTPGVVIAQHIPAGFSTAFAERMNRQTGLVVKEAADGDRIMLGH 226
34497961  242 ALIAPGGKHLLVKRNGAqyvADVKDGPLVSRHRPSVDVLFRSVAVCAGGNAIGVIMTGMGDDGARGMREMHDAGARTVAQ 321
15595371  224 ALVAPGDHHMEVQRSGAnyvVRLNRQAQVNGHRPAVDVMFESLARCAGRNLLAGLLTGMGKDGARGLLAIRQAGGYTLAQ 303
116053894 224 ALVAPGDHHMEVQRSGAnyvVRLNRQAQVNGHRPAVDVMFESLARCAGRNLLAGLLTGMGKDGARGLLAIRQAGGYTLAQ 303
121998939 223 VYIAPGGYHLELHRDGSkyiCRVTEGELVNRHRPSVDVLFNSVATSARANAVGVLLTGMGSDGAVGLGRMQAAGAVTIAQ 302
152984656 224 ALIAPGDYHMQVQRSGAdymVRLNRQPQVNGHRPAVDVMFESLARCAGRNLLAGLLTGMGRDGARGLLAIRQAGGYTLAQ 303
190574200 239 AYLPPGGKHLRIIRDGArwrCRVDDGPAVNRHKPAVDVLFRSVAQSAGGNAIGAILTGMGDDGARGLLEMRQAGAPTLVQ 318
194365620 239 AYLPPGGKHLRIIRDGArwrCRVDDGPAVNRHKPAVDVLFRSVAQNAGGNAIGAILTGMGDDGARGLLEMRQAGAPTLVQ 318
218888918 224 ALVAPGDHHMEVQRSGAnyvVRLNRQAQVNGHRPAVDVMFESLARCAGRNLLAGLLTGMGKDGARGLLAIRQAGGYTLAQ 303
285018138 238 AYLPPGGKHLQVIRDGArwrCKIDDGPPVNRHKPAVDVLFQSVARNAGANAIGAILTGMGDDGARGLLEMLQAGASTLVQ 317
288941944 227 AYIAPGDYHLQLARDGAryvCRLDRSEPVNRHRPSVDVLFRSVAKTAGTNAAAALLTGMGADGAQGLKELYDLGVHTIAQ 306
34497961  322 DEESCVVFGMPAEAINHGGVDEVMSLERIAHMLAGIRG 359
15595371  304 DEATCVVYGMPREAVELGAAEDVLPLERIAAALLQQAA 341
116053894 304 DEATCVVYGMPREAVELGAAEDVLPLERIAAALLQQAA 341
121998939 303 DEASSVVWGMPGAAVKAGHADQVLPLERIAEAIQAAVA 340
152984656 304 DEATCVIYGMPREAVELGAAEDVLPLERIAQALLQQAC 341
190574200 319 DEATSVVWGMPGAAFKLGAAEEQVPLERIAERLLALAR 356
194365620 319 DEATSVVWGMPGAAFKLGAAEEQVPLERIAERLLSLAR 356
218888918 304 DEATCVVYGMPREAVELGAAEDVLPLERIAAALLQQAA 341
285018138 318 DEATSVVWGMPGTAFRLGAAQEVLPLNKIAERLIALSA 355
288941944 307 DEATSVVWGMPGEAVKRGGAVEVLPLRDIAAALLKGLT 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap