Conserved Protein Domain Family
PRK12538

?
PRK12538: PRK12538 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 139048
View PSSM: PRK12538
Aligned: 8 rows
Threshold Bit Score: 393.068
Threshold Setting Gi: 161511102
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146341774   1 MSYALDVRAPADGMSSSEPASPEIMTVPWSESVSTVPDGAPPsEDAVFDEDSELLDRLATGDEVAFRLLVERHIDRAYAI 80
gi 148254594   1 MNYALDVCAPTDGVPLNAPASPDVAEVPWSESASTVPDCSPG-QVAVFDEDKELLDRLATGDETAFRLLVERHIDRAYAI 79
gi 161511102   1 MSFAVDVFARAEAEIATTITSE--ANAPVIASASIAPDGEPVaADVVFDEDSELLDRLAADDETAFRMLVERHIDRAYAI 78
gi 39933716    1 MNGALDVLAPAEVIVAATAPAD--NEASDMPPVEIVLDSPPVsAEMVFDEDADLLDRLATDDEAAFRMLVERHIDRAYSI 78
gi 115522808   1 MTYALDIWAPVEAAPAVMTTPPLAAAMPNEAPCDGAAGPRPP------DDDDRLLARLAGNDEAAFRLLVERHIDRAFSV 74
gi 90422384    1 MAFALDIWAPVEVAPAVIAKSTSVSSAPAAACEQQLPTPP-------LDEDEQLLNRLAEHDEAAFRLLVERHIDRAFGI 73
gi 86747885    6 HTEPVDTLATPPAASATLAPDAIVPHDPDAPR----------------DIDEELLDRLAANDEAAFRLLVERHIDRAFGI 69
gi 192289136   1 MNGALDVLAPAEVIVAATAPAD--NEASDMPPVEIVLDSPPVsAEMVFDEDADLLDRLATDDEAAFRMLVERHIDRAYSI 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146341774  81 ALRIVGSAADAEDVVQDTMLKVWTHRGRWQHGRAKFSTWLYRVVSNRCIDLRRKPRTENVDVVPEVPDGKPDAVSVIERA 160
gi 148254594  80 ALRIVGNAADAEDVVQDTMLKVWTHRGRWQHGRAKFSTWLYRVVSNRCIDLRRKPRTENVDVVPEVADGKPDAASVIERA 159
gi 161511102  79 ALRIVGNAADAEDVVQDSMLKIWSHRGRWQHGRAKFSTWLYRVISNRCIDLRRKPRTENVDTVPEVADGRPDASRVIERN 158
gi 39933716   79 ALRILGNSADAEDVVQDTMLKVWTHRGRWQHGRAKFSTWLYRVVSNRCIDLRRKPRTENVEAVPEVADTQPDAVRVIERN 158
gi 115522808  75 ALRVVGNRADAEDVVQDTMLKVWTHRGQWQQGRAKFSTWLYRVVTNRCIDLRRQPRTDNVDAVPEPADDQPDVVTTIQRD 154
gi 90422384   74 ALRIVGNRADAEDVVQDTMLKVWTHRGQWQHGRAKFSTWLYRVVTNRCIDLHRQPRTDCVDAVPEPADGRPDVVSTMQRD 153
gi 86747885   70 ALRLLGSRADAEDVVQDTMLKVWTHRGRWEHGRAKFSTWLYRVVTNRCIDLHRRPRTDNVDAVPEPADAKPDACSTMQRN 149
gi 192289136  79 ALRILGNSADAEDVVQDTMLKVWTHRGRWQHGRAKFSTWLYRVVSNRCIDLRRKPRTENVEAVPEVADTQPDAVRVIERN 158
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 146341774 161 QMSDLLESAMQRLPEQQRVAVILSYHENMSNGEIAEVMETTVTAVESLLKRGRQQLREMLRRHERDIRGAFTDC 234
gi 148254594 160 EMSDLLEAAMRRLPEQQRVAVILSYHENMSNGEIAEVMDTTVSAVESLLKRGRQQLRDMLRRHERDICGAFTDC 233
gi 161511102 159 ELNGMLEEAMQRLPEQQRIAVILSYHEDMSNGEIAEVMDSTVAAVESLLKRGRQQLRQLLRRHERDIRTAFTDC 232
gi 39933716  159 ELSNLLEAAMQRLPEQQRIAVILSYHENMSNAEIAEVMDTTIAAVESLLKRGRQQLRARLSGDESELRAAFTDF 232
gi 115522808 155 EVSLLLEAAMQRLPEQQRIAMILSYHQDMSNGEIAEVMETTVAAVESLLKRGRQQLRDLLRRNERDIRHIFTD- 227
gi 90422384  154 EVTHLLENAMRQLPEQQRIAVIFSYHENMSNGEIAEVMETTVAAVESLLKRGRQQLRDLLRRHERDIRHVFTEY 227
gi 86747885  150 EITQLLETAIQKLPEQQRVAVILSYHENMSNGDIAEVMSTTVAAVESLLKRGRQQLREILRRHEPDLLQAFTDC 223
gi 192289136 159 ELSNLLEAAMQRLPEQQRIAVILSYHENMSNAEIAEVMDTTIAAVESLLKRGRQQLRARLSGDESELRAAFTDF 232
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap