Conserved Protein Domain Family
PRK12537

?
PRK12537: PRK12537 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 171568
View PSSM: PRK12537
Aligned: 9 rows
Threshold Bit Score: 324.038
Threshold Setting Gi: 28872288
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66043631    1 MSSHESLFDYEATLQACARGEKQALQRLYQQESARLLGVAQRLVRDRALAEDIVHDAFLKIWSHAASFDASRGSARGWIF 80
gi 28872288    1 MSSHESLFDYEATLQACARGEKQALQRLYLQESARLLGVAQRLVRDSALAEDIVHDAFLKIWTHAASFDASRGSARGWIF 80
gi 26989725    1 MNSPAAPFDFHRCLLACAQGDRRALQALYDHEGARLLGVARRIARDDATAEDIVHDAIIRIWTRAASYDPARGSARGWIY 80
gi 134094095   1 MPADSAFFDYDAALHACALGDEHALQRIYIHDSKRLLGVALRIVRQRHLAEDVVHDAFVSIWNKAASFDAKRGEGRGWIY 80
gi 148547902  21 LNSPATPFDFHRCLLACAQGDRRALQALYDHESARLLGVARRIARDDATAEDIVHDAIIRIWTRAASYDPARGSARGWIY 100
gi 152981847  33 LSLNEETFDYDAALRACARGERAALQQIYQQDGKRLLGVALRIVRQRALAEDVLHDAFVNIWRKAGSFDAARGSGRGWIH 112
gi 170722228   1 MNSPLPPFDFQRCLEACARGDRRALHALYEEEGARLLGVVRRIARDHATAEDILHDAFIRIWSGAASFDPARGSARGWIY 80
gi 229590189   1 ------MFDYEACLLACARGDQRALRALYQQESSHLLGVALRIVRDKSLAEDIVHDAFIKIWRGAGSFDPSRGSARGWVF 74
gi 255961268   8 MPLPETAFDYEARLAACARGERGALRELYVQESPRLLGVARRLVRDTALAEDIVHDAFIKIWAGASGFDPARGSARGWMF 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 66043631   81 SVTRHLALNTLRNTTREVRVEDDGSEdhheqaTLEGWQEIGDAFDWQVNPGRITSCLEQLEPVRRNCIFHAYVDGYSHQE 160
gi 28872288   81 SVTRHLALNTLRNTAREVRVEDDGSDdhheqaTLEGWQETGDAFDWRVNPGRMISCMEQLEPVRRNCIFHAYVDGYSHQE 160
gi 26989725   81 SITRHLALNSIRDTRRETVLTDADTE------TASTLHGRVDDLDLWSGSAKIYRCLEQLQPAPQRCILHAYVDGCSHAE 154
gi 134094095  81 SVVRHHALNMLRDRDREVYADEDAIDn----mQHQNQELIIDQFELNDSLGQLQDCLSHLDSAKRNSILCAYVDGCSHSE 156
gi 148547902 101 SITRHLALNSIRDTRRETVLTDADTE------TASTLHGRIDDLELWSGSAKIYRCLEQLQPAPQRCILHAYVDGCSHAE 174
gi 152981847 113 SVVRHQALNLVRDRQQEVYTDEDTVEa----lDAQQGIEAQDPFETHVNLGKLDDCLSHLDHAKRNSLLYAYVDGCSHRE 188
gi 170722228  81 SVTRHLALNYIRDSRREVVLDEGAFD------SAQVPLPYASDMDLMADSAKVHRCLEQLEPSRKLCILHAYVDGCSHAE 154
gi 229590189  75 SVTRHLALNVVRNHYREVPLGDEHEP-----------VAATDTFEFSARTGQVHTCLEQLDPTRRTCILHAYVDGYSHSE 143
gi 255961268  88 SVTRHLALNVLRNHDRETPLNDSNES-----------PAIDDDFDALAQSTRIHRCLHQLEPQRRRCILHAYVDGYSHAQ 156
                        170       180
                 ....*....|....*....|....*...
gi 66043631  161 IAQKIGAPLGTVKAWIKRSLTALRECMG 188
gi 28872288  161 IAQKIGAPLGTVKAWIKRSLTALRECMG 188
gi 26989725  155 IAGLLGAPLGTVKAWIKRSLKALRECLE 182
gi 134094095 157 IAQRLNAPLGSVKAWVKRGLAALRECMG 184
gi 148547902 175 IAGLLGAPLGTVKAWIKRSLKALRECLE 202
gi 152981847 189 IAERMKSPVGSVKAWIKRGLLALRECMG 216
gi 170722228 155 IAGLLNTPLGTVKAWIKRSLKALRECMG 182
gi 229590189 144 IAQKLDTPLGTVKAWIKRSLAALRECMT 171
gi 255961268 157 IAQRLDTPLGTVKAWIKRSLNALRECMG 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap