Conserved Protein Domain Family
PRK12536

?
PRK12536: PRK12536 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 237131
View PSSM: PRK12536
Aligned: 22 rows
Threshold Bit Score: 271.154
Threshold Setting Gi: 291481536
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238028043   4 AEDRLKTLFVSGLDGDAKAYHGFLQELTRHLRGYLRKRIPQLHDDVEDLVQEILLAVHHARHTYRTDEPLTAWVHAIARY 83
gi 91783635   13 KEAHLRALFLSGLDGDSAAYRQFLAELGAHLRGFLRRRLHDGASDAEDLMQEILLAVHNARHTYRSQEPLTAWIHAIARY 92
gi 71908204   13 REDRLKDLLVRSLAGDNAAYQVFLTELSAHLRAFLRRRLVRLPDEIEDLVQESLLAVHNQRHTYDSAQPLSAWVQAIARY 92
gi 71907152   13 KEDRLKTLLMRGLAGENAAYQVFLTELSAHLRAFLRRRLIQLPDEVEDLVQEALLAVHNQRHTYEPGQPLSAWVQAIARY 92
gi 152981873  25 SELRLHALLVQGLAGDQVAYRNFLQLTATHLRAFLRRRLSRWPDEVEDLVQESLLAIHNQRATYDVNAPLTAWVYAIAKY 104
gi 187919831   4 AEQRLKTLLVAGLAGNASDYRLFLSELTRHLRGYLRKRIPQLHDDVEDLVQEILLAVHNARHTYRPDEPLTAWVHAIARY 83
gi 187919842  13 VEERLKALFVRGLDGNAAAYQAFLSDLTGHLRGFLRKRLFYLQDDVEDLVQEILLAVHNGRHTYRPDQPLTAWVHAIARY 92
gi 238025167  13 TEQALRQWLLAGLDGDEAAYRRFLSALCAYLRGFVRRRLANRPADVEDLVQEMLLAIHDKRHTYRAGEPLTAWVHAIARY 92
gi 239815647  10 AEAALRSLFLRGLDGDAAAYREFLQKLSAHLRAFLGKRLFGWPDEVEDLVQECLLAMHNQRHTYQSDQPLTAWVHAIARY 89
gi 291481536  46 VEQRLRALLLAGLGGDQAAYHAFLTELTGRLRAFVRRRLYQLQDEVEDIVQETLLAVHNARHTYRAEEPLTAWVYAIARY 125
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238028043  84 KLMDLFRSRFRRQALDVPFDDDHEaLFTAPDDEPA-QARRDIGKLLAHLPDKQRLPILHVKLQGLSVTETAALTGLSESA 162
gi 91783635   93 KLTDYFRARARHDALNDPLDDAFE-LLAAPDLEPA-QAKRDVGKLLEQLPDRQRLPIVHVKLEGLSVTETAKLTGLSESA 170
gi 71908204   93 KLVDLLRRRAAYDLLNDPLDEEME-LFTTADSDAA-EARRDLNKLLADLPDQLRLPIVHTKLEGLSVKEAADLIGMSESA 170
gi 71907152   93 KLVDLLRRRAVHETLNDPLDEAME-VFSSSDTEAA-EARRDLNKLLADLPEQQRLPIVHTKLEGLSVKETADLTGMSESA 170
gi 152981873 105 KLIDWLRRHARRETLNDPLDDENE-LFTTADSDAH-EAQRDLGKLLELLPEQQRAAIVHTKLDGWSVRETAAALNISEAS 182
gi 187919831  84 KLMDFFRTRARRESLHEPLDEHDD-IFAECDDEPA-DARRDVGKLLGHLPDKQRLSILHVKLQGLSVAEAAQLTGLSESA 161
gi 187919842  93 KLADFFRARSRREALHMPLDDELE-IFATCDVEPA-EARRDLSKLLEQLPDRQRLPILHVKLEGLSVTETAKLTGLSESA 170
gi 238025167  93 KLIDDFRAWSRQDALNQSFDDESE-WLAAPESEPF-EARRDLAKLLDTLPDRQRLPILHVKLEGLSVAETARMTGLSESA 170
gi 239815647  90 KMIDLLRAKSAREALHDPLDDDLA-VFAESAIEAS-DARRDLGGLLQTLPDRQRLPIVHVKLEGLSVAETASLTGMSESA 167
gi 291481536 126 KLLDFLRSRSRHGA-TESLDDVAD-ILCHSDDAPAhDARLDLSGLLEQLPDKQRLPILHVKLEGLSVAETARLTGLSESA 203
                        170       180
                 ....*....|....*....|
gi 238028043 163 VKVGVHRGLKALAARIRGER 182
gi 91783635  171 VKIGVHRGLKALAARIRGTR 190
gi 71908204  171 IKVGVHRGLKALAAKIRGAL 190
gi 71907152  171 IKVGVHRGLKALALKIRGIL 190
gi 152981873 183 VKVAVHRGLKALAIKLQDES 202
gi 187919831 162 VKVSIHRGLKALAAHVRRIA 181
gi 187919842 171 VKVGVHRGLKALALKFQGTS 190
gi 238025167 171 VKIGVHRGLKALAAKIRGTR 190
gi 239815647 168 VKVGIHRGLKALAARLRSRA 187
gi 291481536 204 VKVGIHRGLKALAAKARLFT 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap