Conserved Protein Domain Family
PRK12529

?
PRK12529: PRK12529 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 183574
View PSSM: PRK12529
Aligned: 7 rows
Threshold Bit Score: 318.033
Threshold Setting Gi: 33600889
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116053045   1 MNAPSPCLQADRDCVATLYRENHAWLRNWLAYRLRSWGRGVADDLAHDTFLRILASRDGGQRDAIRQPRAYLTRIANCVL 80
gi 15600089    1 MNAPSSCLSADRDGVATLYRENHAWLRNWLAYRLRSWGRGVADDLAHDTFLRILASRDGGQREAIRQPRAYLTRIANCVL 80
gi 152988617   1 MNAPSPCLSADRGSVATLYLENHAWLRGWLAYRLRSWGREVADDLAQDTFLRILASHDAAQREAIRQPRAYLTRIATCVL 80
gi 218893991   1 MNAPSSCLSADRDGVATLYRENHAWLRNWLAYRLRSWGRGVADDLAHDTFLRILASRDGGQREAIRQPRAYLTRIANCVL 80
gi 104779877   2 TTFETPPLRTTPCAVTTLYLENHAWLRGWLAYRLRSWGHGVADDLAQDIFLRVLSNRDATQPDTLRQPRAYLARIANCVL 81
gi 33600889    2 KACSPSSGMCGRDKVAALYQEHHAWLRSWLGYRLHSWGRCVAEDLAHDIFVRMLAAHRLDQ--MIERPRAYLAVAAKGVL 79
gi 33597044    2 KACSPSSGMCGRDKVAALYQEHHAWLRSWLGYRLHSWGRCVAEDLAHDIFVRMLAAHRLDQ--MIERPRAYLAVAAKGVL 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 116053045  81 VSWRRRQSLELAWLEALATLPEPLQPSPEQQSVIVETLHEIDALLDTLRPRVKQAFLMATLDGMKQKDIAQALGVALPTV 160
gi 15600089   81 VSWRRRQSLELAWLEALATLPEPLQPSPEQQSVIVETLHEIDALLDTLRPRVKQAFLMATLDGMKQKDIAQALGVALPTV 160
gi 152988617  81 VSWRRRQSLELAWLEALATLPEPLQPSPEQQSVIVETLHEIDALLDTLRPRVKQAFLMATLDGMRQKDIAEALDVALPTV 160
gi 218893991  81 VSWRRRQSLELAWLEALATLPEPLQPSPEQQSVIVETLHEIDALLDTLRPRVKQAFLMATLDGMKQKDIAQALGVALPTV 160
gi 104779877  82 VSWRRRHSLEQAWLEALAQVPEPEHPSPEQQSVILETLHEIDAVLDTLRPRVRQAFLMATLDGMKQKDIAQALNIALPTV 161
gi 33600889   80 VSWLRRQSLERAWLETLQALPPAMHPSPERQALALETLHGIDAALDTLRPCIKRVFLMAVLGGMKQRDIAHAMDIAIPTV 159
gi 33597044   80 VSWLRRQSLERAWLETLQALPPAMHPSPERQALALETLHGIDAALDTLRPCIKRVFLMAVLGGMKQRDIAHAMDIAIPTV 159
                        170
                 ....*....|....*...
gi 116053045 161 KKFIHQAYVTCLSLMPDE 178
gi 15600089  161 KKFIHQAYVTCLSLMPDE 178
gi 152988617 161 KKYIHQGFLTCLSLMPDD 178
gi 218893991 161 KKFIHQAYVTCLSLMPDE 178
gi 104779877 162 KKYIHEGYLTCLSQMPDD 179
gi 33600889  160 KRYMRQAYVACLHLMPDD 177
gi 33597044  160 KRYMRQAYVACLHLMPDD 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap