Conserved Protein Domain Family
PRK12528

?
PRK12528: PRK12528 
RNA polymerase sigma factor; Provisional
Statistics
?
PSSM-Id: 171561
View PSSM: PRK12528
Aligned: 13 rows
Threshold Bit Score: 280.577
Threshold Setting Gi: 152984061
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167035585   1 MPSalsSTVEGLYHAHHNWLTSWLRRRLGCPQSAADLAQDTYLRLLQARETPQLIEPRAFLATVAKRVLCNHFRRQELER 80
gi 116051936   7 AHA---AALHTLYSDHHHWLTGWLRRRLGCPQNAADLAQDTFVKVLVSRQAARIDEPRAFLTTIARRVLCNHYRRQDVER 83
gi 15599094    7 AHA---AALHTLYSDHHHWLTGWLRRRLGCPQNAADLAQDTFVKVLVSRQAARIDEPRAFLTTIARRVLCNHYRRQDVER 83
gi 152984061   7 AHA---AALHTLYSDHHHWLTGWLRRRLGCPQNAADLAQDTFVKVLVSRQATRIDEPRAFLTTIARRVLCNHYRRQDVER 83
gi 218889820   7 AHA---AALHTLYSDHHHWLTGWLRRRLGCPQNAADLAQDTFVKVLVSCQAARIDEPRAFLTTIARRVLCNHYRRQDVER 83
gi 77457152    4 SSA---HPVESLYQAHHSWLTGWLRRRLGCPDSAADLAQDTFIRLLTAREPAVIIEPRAFLTTLAKRVLFNHYRRQDLER 80
gi 229588583   5 SPS---NTVEVLYNDHHRWLTGWLRRKLGCPESAADLAQDTFIRVLTARETPPLIEPRAFLTTVAKRVLFNFYRRQDLER 81
gi 70728366    2 SHT---ATVEGLYQAHHSWLNTWLRRRLGCPHSAADLAQDTFIRVLSARETPALIEPRAFLTTIAKRVLFNHYRRQDLER 78
gi 26991295    7 VTSaltSTVEGLYHAHHNWLTGWLRRRLGCPHSAADLAQDTYMRLLQAREAPQLVEPRAFLATVAKRVLCNHFRRQELER 86
gi 161611338   4 AHSalnHTVESLYRAHNTWLTTWLRRRLGCPHSAADLAQDTFIKVLGARDTQQIVEPRAFLTTIAKRVLCNHYRRQDLEH 83
gi 66044293    4 AHSalnHTVEGLYRAHNAWLTTWLRRRLGCPHSAADLAQDTFIKVLGARDTAQIVEPRAFLTTIAKRVLCNHYRRQDLEH 83
gi 28868422    5 AHSapnHTVEGLYRAHNVWLTTWLRRRLGCPHSAADLAQDTFVKVLGARDTAQIIEPRAFLTTIAKRVLCNHYRRQDLER 84
gi 104783537   1 MPSalsSTVEGLYVAHHSWLTGWLRRRLGCPQSAADLAQDTYVRLLQARETPQLIEPRAFLTTVAKRVLCNHFRRQELER 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167035585  81 AYLQALAQIPEEVAPSEEQKAIIFETLLELDRLLDGLPPLVKRAFLLAQVDGLGQGEIARELGISLATVKRYLSKAAMRC 160
gi 116051936  84 AYLEALASLPEREVPSEETRAIVLETLVELDRLLDGLPPLAKETFLLAQLDGLGYAEIATQLGISLSSVKRYMLKAAQRC 163
gi 15599094   84 AYLEALASLPEREVPSEETRAIVLETLVELDRLLDGLPPLAKETFLLAQLDGLGYAEIATQLGISLSSVKRYMLKAAQRC 163
gi 152984061  84 AYLEALASLPECELPSEETRAIVLETLVELDHLLDGLPPLAKETFLLARLDGLGYAEIATQLGISLSSVKRYMLKAAQRC 163
gi 218889820  84 AYLEALASLPEREVPSEETRAIVLETLVELDRLLDGLPPLAKETFLLAQLDGLGYAEIATQLGISLSSVKRYMLKAAQRC 163
gi 77457152   81 AYLDTLAQMPEMVAPSEEEKAIILQTLMELDQLLDGLPRAVKRAFLMAQVDGLTYPQIATELGISVATVKRHLNKAAMRC 160
gi 229588583  82 AYLDALAHMPEHVAPSEEERAIILQTLVELDQLLDGLPVQVKRAFLLAQLDGLTYAQIGAELGISIATVKRHLNKAAMRC 161
gi 70728366   79 AYQETLAQMPEQVAPSEEERAIILQTLMELDSLLDGLPRPVKRAFLLCQLDGLTYGEIARELNISIATVKRHLNKAAMRC 158
gi 26991295   87 AYLQALAQVPEEVAPCEEQKAIIFETLLALDHLLDGLPPLVKRAFLLAQVDGLGQGEIARELGISLATVKRYLNKAAMRC 166
gi 161611338  84 AYYQALAELPECVAPSEEERAIILETLVELDQLLDGLPVLVKRAFLMSQVDGLSHGQIAAELGISIATVKRHLNKAALRC 163
gi 66044293   84 AYYQALAELPERVAPSEEERAIILETLVELDQLLDGLPALVKRAFLLSQVDGLSHGRIAAELGISIATVKRHLHKAALRC 163
gi 28868422   85 AYYQALAELPECAAPSEEERAIILETLVELDQLLDGLPALVKRAFLMSQVDGLSHGQIAAELDISIATVKRHLNKAALRC 164
gi 104783537  81 AYLEALAQVPEQVAPSEEDKAIIFATLLELDRLLDGLAPLVKRAFLLAQVDGLGQGEIARELGISLATVKRYLNKAALRC 160

                 ....
gi 167035585 161 YFAL 164
gi 116051936 164 YFAE 167
gi 15599094  164 YFAE 167
gi 152984061 164 YFFD 167
gi 218889820 164 YFAE 167
gi 77457152  161 YFAL 164
gi 229588583 162 YFAL 165
gi 70728366  159 YFAL 162
gi 26991295  167 YFAL 170
gi 161611338 164 YFAL 167
gi 66044293  164 YFAL 167
gi 28868422  165 YFAL 168
gi 104783537 161 YFAL 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap